KEGG   Elaeis guineensis (African oil palm): 105061231Help
Entry
105061231         CDS       T03921                                 

Definition
(RefSeq) enoyl-[acyl-carrier-protein] reductase [NADH] 1, chloroplastic-like
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
egu  Elaeis guineensis (African oil palm)
Pathway
egu00061  Fatty acid biosynthesis
egu00780  Biotin metabolism
egu01100  Metabolic pathways
egu01212  Fatty acid metabolism
Module
egu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:egu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    105061231
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    105061231
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    105061231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:egu01004]
    105061231
Enzymes [BR:egu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     105061231
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     105061231
Lipid biosynthesis proteins [BR:egu01004]
 Fatty acid synthase
  Component type
   105061231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4781 Enoyl_reductase
Motif
Other DBs
NCBI-GeneID: 105061231
NCBI-ProteinID: XP_010943515
LinkDB All DBs
Position
Unknown
AA seq 388 aa AA seqDB search
MATVAAGGLPLAATGPCISSSGRVFMPSAAILGVDVKGTSQVKFASSSHISSVKSLSQSF
MFAPLKFASVVTRAMSGETEKGIASGLPIDLRGKRAFIAGIADDNGYGWAIAKAFAAAGA
EILVGTWVPALNIFETSLRRGEFDESCRLPNGSLMEIIKVYPLDAVYETPEDVPDDVRTN
KRYSGASNWTMKLPSLLEVAESVKNDFGSIDILVHSLANGPEVAKPLLETSRKGYLAAIS
ASSYSFISLLKHFVPIMNPGGASISLTYIASERTIPGDGGGMSSAKAALESDTRVSFEAG
RKGKIRVNTISAGPLGSRAAKAIGFIEKMIDYSYANAPLQKELLAEEVGNTAAFLVSPLA
SAITGSVVYVDNGLNTMGLATDGPTLAV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtggcagctgggggcctgccattggcagccacagggccctgcatctcttct
tctggcagagtgttcatgccaagtgccgcaattttaggggtggatgtaaaaggaacgagc
caagttaaatttgcaagctcttctcatatctcctctgttaaatctcttagccaaagcttc
atgtttgctcctttgaagttcgctagtgttgttacgagggctatgtctggtgaaactgag
aaagggattgcttcaggattgcccattgatctgagaggtaaaagggcattcattgctggt
atagctgatgataatggctatggttgggcaattgctaaggcttttgctgctgctggtgct
gaaattcttgttggtacatgggtgcctgcacttaacatttttgagactagcttaagacgt
ggcgaatttgatgagtcatgccggttgcccaatggttctcttatggagataatcaaagta
tacccattggatgcagtttatgaaactcctgaggatgttcctgatgatgttagaactaat
aagcgttattctggtgcctcgaattggactatgaagctcccttctttgttggaagtggct
gaatctgtcaagaatgattttggaagcatagacattcttgtgcattcacttgcaaatgga
ccagaggttgccaaacctctcttggagacatctagaaagggatatcttgctgctatatct
gcatcaagttactcttttatatcactacttaagcacttcgttccaataatgaatccaggt
ggtgcttcaatctccttaacatacattgcttctgaaaggaccattcctggggatggtgga
ggcatgagttcagcaaaagcagccctagagagtgataccagagtatcttttgaagcaggg
aggaagggcaagatcagagtgaatacaatatccgcaggccccttgggaagtcgtgctgcc
aaggcaattggattcatcgagaagatgatagattattcttatgccaatgcaccattgcag
aaagaattgttggcagaagaagtcggcaatacagcagcattccttgtgtctcctttagct
tcagcaataactggctccgtggtttatgtcgacaatgggttaaacaccatgggactagcc
accgacggcccaacgctagcagtatag

DBGET integrated database retrieval system