KEGG   Elaeis guineensis (African oil palm): 109505392Help
Entry
109505392         CDS       T03921                                 

Definition
(RefSeq) uncharacterized protein LOC109505392
Organism
egu  Elaeis guineensis (African oil palm)
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO Thi4 K_oxygenase Glutaredoxin FAD_binding_3 NAD_binding_7 NAD_binding_8 G3P_acyltransf
Motif
Other DBs
NCBI-GeneID: 109505392
NCBI-ProteinID: XP_019703436
LinkDB All DBs
Position
Unknown
AA seq 530 aa AA seqDB search
MLDTSLKTQLQAYLGKLQRPIRLIASLDASAGAAEMKELLQEIAGLSDLVSFDESGTDAR
KPSFVIARDGEATGVRFAAIPLGHEFTSLVLALLWTGGHPPKVEAAVIDQIKGLEGDFNF
EMYMSLSCHNCPDVVQALTLMSILNPAVKATVIDGGLYQAEVEERQILAVPMVFLNGELF
GSGRMLLEEIVAKLDVKSDEREAAKLNAKDPFDVLIVGGGPAGAAAAVYAARKGIRVGVA
AERFGGQTNDTMAIENYISVLETDGPKFAAALEAQVRHYDVDIMNLQRADKIIPATEAGG
LVQVQMANGAVLQARSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKDVAVI
GGGNSGVEAAIDLAGIVKHVTLVEFADALKADAVLVSKLKSLPNVTINVNAQTTEITGAG
GKVNGMSFKDRVSGEVKHVALEGVFVQIGLVPNTEWLKGTVDLSRYGEIEIDAKGHTNVP
GVFAAGDCTTVPYKQIVIAAGDGSKAALSAFDYLIRQPVVVAKAEEAVAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccagtctaaagacccaactgcaggcgtacctcggcaagctgcagcgtccg
atccgtttgatcgcttcgctggacgccagcgccggcgcggccgagatgaaggagttgctg
caggaaatcgccgggctgtccgatctggtgagcttcgacgagagcggcaccgatgcgcgc
aagccctcgttcgtgatcgcccgcgacggtgaagccaccggcgtgcgttttgcggccatt
ccgctcggccacgagttcacctcgctggtgttggcactgctgtggacgggtggtcatccg
cccaaggtcgaggccgccgtgatcgatcagatcaagggcctggaaggcgacttcaacttc
gagatgtacatgagcctctcgtgccacaactgcccggacgtggtgcaggcgctcacgctg
atgtccatcctcaacccggccgtgaaagccaccgtgatcgacggtggtctgtaccaggcc
gaggtggaagagcgccagatcctggccgtgcccatggttttcctcaatggtgagctgttc
ggctcgggccgcatgctgctggaagaaatcgtcgccaagctggacgtgaagtctgacgag
cgcgaggccgccaagctcaacgccaaggaccccttcgatgtgttgatcgtcggcggtggc
ccggccggtgcggccgctgcggtgtacgccgctcgcaagggcatccgcgtgggtgtggcc
gccgagcgtttcggtggccagaccaacgacaccatggcgatcgagaactacatcagcgtg
ctggaaaccgacggccccaagttcgctgccgcgctcgaagcccaggtgcgccactacgac
gtggacatcatgaacctgcagcgcgccgacaagatcattccggccacggaagcgggtggt
ctggtgcaggtgcagatggccaacggtgcggtgctgcaggcgcgcagcgtgatcctctcc
accggcgcgcgctggcgcaacgtgaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctactgcccgcattgcgacggcccgctcttcaagggcaaggacgtggcggtgatc
ggtggtggcaactccggcgtggaagccgcgatcgacctggccggcatcgtgaagcacgtg
acactggtcgaattcgccgacgccctcaaggccgacgcggtgctggtgagcaagctcaaa
agcctgcccaacgtgaccatcaacgtgaatgcgcagacgaccgaaatcacgggcgctggc
ggcaaggtcaacggcatgagtttcaaggaccgtgtgagcggcgaggtgaaacacgtggcg
ctggaaggtgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcaagggcacc
gtggacctgagccgctacggcgagatcgagatcgatgccaagggccacaccaacgtgccc
ggcgtgtttgcagcgggcgactgcacgacggtgccgtacaagcagatcgtgatcgccgcg
ggtgatggctccaaggccgcgctcagcgccttcgactacctgatccgccagccggtggtg
gttgcaaaagccgaagaggccgtcgccgcctga

DBGET integrated database retrieval system