KEGG   Enterococcus gilvus: EGCR1_15615Help
Entry
EGCR1_15615       CDS       T05664                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
egv  Enterococcus gilvus
Pathway
egv00040  Pentose and glucuronate interconversions
egv00051  Fructose and mannose metabolism
egv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EGCR1_15615
   00051 Fructose and mannose metabolism
    EGCR1_15615
Enzymes [BR:egv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     EGCR1_15615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 UDPG_MGDP_dh_N Glu_dehyd_C TrkA_N NAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AXG40147
UniProt: A0A345FWL5
LinkDB All DBs
Position
pCR1A:complement(340259..341323)
Genome map
AA seq 354 aa AA seqDB search
MKAALLKGLNQFEIEEIKKPVPLDHEVLVKVKAAGICGSDIHKMQNEWKYGLPMVMGHEF
AGVIEAVGSGVKQVSIGDRVAIAPLIPCHECTYCKSGKYQLCEHYTMIGSHHYGGFEEYV
AVPEENVINIGEILSFEEAAMIEPLAVAAHGVMGLEPKIGDTVAVFGLGTIGILTVQWLR
LTGVKKIIGIDIDPNKLAEAKKYGVTDTINSLEEPLEERIAELTNEMGVDIAIECAGSKI
TEEQCLLITKKGGKIGYQGIAYSDVLLHQRAFENIFRREYTIQGFWNSYSAPFPGKEWLH
SATFIEQGKIQLKDLISHRFELEDIQKAFDLTVNREESYNKVMIFPESREGETK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgttgttaaaaggattaaatcaatttgaaatcgaagaaatcaaaaagcca
gtaccgttggatcatgaggtcttggtaaaggtaaaggccgctggaatctgcggatcagac
atccataaaatgcaaaatgagtggaaatatggcttgccgatggttatgggacatgaattt
gcaggcgtgatcgaagccgtagggtctggggtaaaacaagtctccataggggatcgtgta
gctattgctcctttaatcccttgccatgaatgtacctattgtaaatcagggaaatatcaa
ttatgtgaacattacaccatgatcggttcgcatcattatggcgggtttgaagaatacgta
gctgttcctgaagagaatgtcatcaatattggagaaatcctttcgttcgaggaagcagcg
atgatcgaaccactggcagtggcggcccatggcgtgatggggctggagccaaaaatcggc
gataccgtagcagtattcgggctaggaacaatcggaatattgaccgttcaatggctccgt
ttaacgggagttaaaaaaatcatcgggattgatatcgacccgaataagcttgccgaagcg
aagaaatatggcgttaccgatacgatcaattctttggaagaaccgttggaagaacggatc
gctgaattgacaaacgagatgggtgtcgatatcgcgatcgaatgtgccggttccaaaatt
acagaagaacagtgtttgttgattaccaaaaaaggcggaaaaatcggctatcagggaatc
gcctattcagatgtgctgctgcatcaacgggcctttgaaaacatttttagacgggaatat
acgatacaagggttttggaattcttattccgccccatttcctgggaaagaatggctacat
tcggcaacctttatcgaacaaggaaaaattcagttaaaggacttgatctcacatcgcttt
gagctggaagacattcaaaaagcttttgacctcacagtgaaccgtgaagaatcctacaat
aaagtaatgatttttcctgaaagcagagagggggaaacaaaatga

DBGET integrated database retrieval system