KEGG   Egretta garzetta (little egret): 104121808
Entry
104121808         CDS       T05152                                 

Gene name
CDC25A
Definition
(RefSeq) M-phase inducer phosphatase 1
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104121808 (CDC25A)
   04218 Cellular senescence
    104121808 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104121808 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egz01009]
    104121808 (CDC25A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egz03036]
    104121808 (CDC25A)
   03400 DNA repair and recombination proteins [BR:egz03400]
    104121808 (CDC25A)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     104121808 (CDC25A)
Protein phosphatases and associated proteins [BR:egz01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    104121808 (CDC25A)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104121808 (CDC25A)
DNA repair and recombination proteins [BR:egz03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    104121808 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 104121808
NCBI-ProteinID: XP_009632149
LinkDB
Position
Unknown
AA seq 509 aa
MHASFLIFTLSLAERLTKAAAASRLRLPGSGDQHENAEQDLGNKNTNGLQRTVSSESTDS
GCALDLPDPATSNDIMEETFEKAILESSRLNIRMPFRRIHSLPQSLLGCSPALKRNHSNS
QDSDGFQLLEQDENKENESFEFKKPTKPASRSSVHVYSRDGKGAPGPRQNSSPAQTFSTG
EVAMGEQEDYRPAFLQQSSLTSSESEDDDGFLELLDEQDLKNDEEMPSDVASLWTAPLVM
RKTDNRAKRCRLFGSSSLLSGVGRTTQKRMERSQEENSPGKSKKRKSLPGTPSEDSTSLK
IVRTRSSTAEIESILDSDQRDLIGDFSKGYLFHTVDGKHQDLKYIDSEMIVSVLTGKFAS
FIKECVIIDCRYPYEYEGGHIKGAVNLHMEEDVEDYLLKKPIQPSENKRVIIVFHCEFSS
ERGPRMCRFVRERDRLGNEYPNLHYPELYVLKGGYKDFFLRCRSFCEPQSYRPMHHEDFK
EDLKRFRTKSRTWAGEKSKRELYSRLKKL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcatgccagcttcttgattttcacgctgtcgctcgccgaacgcctcacaaaagcggcc
gccgcttcccggctccggctgcccggttccggggatcagcatgaaaatgctgagcaagat
ctgggaaacaagaatactaatggtttacaaagaacggtgtcatcggaatcaacagactca
ggttgtgctttggatttgcccgatcctgcaacctcgaacgatatcatggaggaaacgttt
gagaaagcaattcttgaatccagcagactgaacattcgaatgcctttcagaagaatacat
tcgctgccacaaagcctcctgggatgcagtcctgctctgaagagaaaccattccaattcc
caggacagcgatggttttcaactgttggaacaagatgaaaataaagagaatgaatcgttt
gagtttaagaagccaaccaaaccagcttctcgtagttctgtgcatgtctattcccgtgat
ggaaaaggtgctcctggaccaaggcagaattcatctccagctcagacattttccactggt
gaagtggccatgggtgaacaggaagactacaggccagctttcctgcagcagtcttctctg
acttcctctgaaagtgaagatgatgatggattcctagagctgctagatgagcaagattta
aagaacgatgaggagatgccatctgatgtggcgagcctctggactgcaccactagtcatg
aggaaaacagacaatcgggccaaacgatgccggttgttcggctcttcgtctctgcttagt
ggtgtaggaagaaccacccagaaaaggatggagagatcccaggaagagaattctccaggg
aaaagcaagaagaggaaaagcctgcctggaacgccttctgaggattcaacgagtttgaaa
atagtaaggacacgatcctccacggcagagattgaaagcattttggacagcgaccagaga
gatcttattggtgacttctcaaagggttatttattccacactgtcgacgggaaacatcaa
gatttaaaatatatcgactcggaaatgattgtgtctgttctgactgggaagtttgcgagc
ttcatcaaggaatgtgtgataattgattgtagatacccatatgagtacgaaggagggcac
atcaagggtgctgtaaacctacatatggaagaggatgtggaagactacttgcttaagaag
ccaatccagccgtcggagaacaaacgagtgataatagtgttccactgcgagttttcttca
gagcgtgggcctcgaatgtgccggtttgtgagagagcgggacaggctgggtaatgaatac
cccaacctccattacccagagctctatgtcctgaaggggggttacaaggacttctttctc
agatgccgtagtttctgcgagccccagagctatcgccccatgcaccacgaggactttaaa
gaagacttgaaaaggttccgcaccaaaagccgaacctgggctggtgagaagagcaaaagg
gaactgtacagtcgcctgaagaagctctaa

DBGET integrated database retrieval system