KEGG   Egretta garzetta (little egret): 104121908
Entry
104121908         CDS       T05152                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00220  Arginine biosynthesis
egz00330  Arginine and proline metabolism
egz01100  Metabolic pathways
egz04020  Calcium signaling pathway
egz04146  Peroxisome
egz04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    104121908 (NOS2)
   00330 Arginine and proline metabolism
    104121908 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104121908 (NOS2)
   04020 Calcium signaling pathway
    104121908 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104121908 (NOS2)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     104121908 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6 DUF1400
Other DBs
NCBI-GeneID: 104121908
NCBI-ProteinID: XP_009632268
LinkDB
Position
Unknown
AA seq 1158 aa
MLCPWKFAFKPQADKNQSSEEKDINNNVEKNRKVHGLGDDAAKLYDLSKKRMEMPPIITS
AKASDGRENPPQNGIKASNQISRCPRHVKVRNMENGSSFLDTLHLTAKEVINCRTKACQG
ALMTPKGLVRGTRDGPVPPAELLPQAIDFIKQYYNSFKEPKIEEHLDRLETVAKEIETTG
TYHLTKDELIFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFEHICRHVQYATNN
GNIRSAITIFPQRTDGKHDFRVWNSQLIRYAGYQMPDGSIVGDPASVEFTQLCIDLGWKP
KYGRFDVVPLILQANGQDPEIFEYPPEIVLEVPMEHPKYEWFKELDLKWYALPAVANMLL
EVGGLEFTGCPFNGWYMGSEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLYSFQKQNVTIMDHHSAAESFMKYMQNEYRVRGGCPADWVWIVPPISGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDESRRPKKNELKFSILAKAVLFASSLMRQTMAARS
KVTVIYATETGKSETLANNLCSLFNCAFNTKILCMDEYNICDLEKETLLLVVTSTFGNGD
SPNNGKTLKNSLLTLKLLRKKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPVG
EGDELNGQEEAFRAWAVSAFKTACDIFNIRGKNSIQLPEIYTSDENWDPKNYRIVHDSQT
MDLAKALANVHAKDIIPMKLKFRQNLQSLKSSRVTILVKLSCETNQEVHYLPGEHIGIFP
GNQPELVHGLIAHVKDAPPADQTIRLETCTGGGYWTSDKRIPACTLPEALTYLLDITTPP
SQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSADVSTAFLL
TQLPLLKPRYYSVSSSCDMTPREIHLTVAVVNYRTRDGQGPLHHGVCSTWLNTIALNEIV
PCFIRSANGFQLPEEPTKPCILIGPGTGIAPFRSFWQQRLYDLEKKGIKGGDMTLLFGCR
QPDMDHIYREETEEMKRKGVLKEVYTAYSRQPGQAKVYVQDILQSKLDTKVCNLLHKEEG
HLYVCGDVRMARDVAQTLKGMLAKKLNLNEQQAEEYFFQLKSQKRYHEDIFGAVFPYEAK
RGVRALQPTSPRTNQLMF
NT seq 3477 nt   +upstreamnt  +downstreamnt
atgttgtgcccatggaagtttgcattcaaacctcaagctgataagaaccagtcctctgaa
gagaaggatatcaataacaacgtggagaaaaataggaaggtccatggcttaggagatgat
gctgccaaattatatgatctgagcaagaagcggatggagatgccacctatcataacttca
gcaaaggccagtgatgggagagagaacccgccccaaaatggtatcaaagcttcaaaccaa
atatcaagatgtccaagacatgtaaaagtaagaaacatggaaaatggatccagcttcctc
gacacactgcacctgacagcaaaggaggttatcaactgccggaccaaggcctgccaaggg
gcactcatgaccccaaagggcctggtgagaggtactagagatgggccagttccaccagca
gagcttttacctcaggcaatagactttatcaagcagtactacaattcatttaaagagcca
aaaatagaagaacacctggaccgactggaaacagtggcgaaggagatagaaacaacagga
acctaccatctgacaaaggatgaactgatctttgctgccaaacaagcctggaggaacgcg
cctaggtgcattgggagaatccagtggtccaatctgcaggtatttgatgcacgtgattgt
aaaacagcgaaggaaatgtttgagcatatctgtcgtcatgttcagtatgccacaaacaat
ggaaatataagatcagccatcactatcttcccccagaggactgatgggaaacacgatttc
cgtgtttggaacagccagctcatccgatacgctggatatcaaatgccagatgggtctatt
gtaggagaccctgccagtgtggagttcacccagctgtgcattgaccttgggtggaagccg
aaatatggccgctttgatgtagttccactcattctccaagcaaacggccaagacccagaa
atatttgaataccctccagaaattgtcctcgaagtaccaatggagcatccaaagtatgaa
tggtttaaggagctggatctgaagtggtatgcgctgcctgctgttgccaacatgcttctt
gaggtgggaggcctggaatttactgggtgtcctttcaatggctggtacatggggtcagag
ataggagtgcgagacttctgtgatgtacagcgatacaacatcctgaaggaggtaggaaga
agaatggggctggaaacaaacaaactttcatcgttgtggaaagaccgagctgttgtagag
ataaatgtggctgtgctttacagcttccaaaaacaaaatgtgactatcatggatcaccac
tcagctgccgagtccttcatgaaatacatgcagaatgagtaccgtgtgcgaggaggctgc
ccggctgactgggtgtggattgtacctcccatatcagggagcataacccccgtgttccac
caggagatgttgaactatgtcctcactcccttctattactaccaggtagatgcatggaaa
acacatgtctggcatgatgagagccggaggccaaagaaaaacgaattaaaatttagcatc
ttggcaaaggctgtactctttgcatcttcactcatgcgacaaacaatggcagccaggtcc
aaggtcactgtaatctatgcaacagagactgggaaatctgaaacactagccaacaatctg
tgcagcttgttcaactgtgccttcaacactaagattctatgcatggacgaatacaacatc
tgtgacctggaaaaagaaacacttcttttagtagttactagcactttcggaaatggagat
tctccaaataacggaaagaccttgaagaactccttgctcaccctgaaattgctgagaaaa
aaaattagatatgctgtgtttggattggggtccagcatgtatccagagttctgtgccttt
gctcatgccattgaccaaaaactggcccaactcggggcttctcagctcactccagtaggt
gaaggagatgaactcaatgggcaagaagaagcctttcgcgcatgggcagtcagtgcgttc
aagactgcctgtgacatttttaacatccgcgggaaaaacagtattcagttgcctgagata
tatacctctgatgaaaactgggatccaaagaattacaggatagtgcatgactctcaaacc
atggatttggctaaagcacttgcaaacgttcatgccaaggatatcattcccatgaagctg
aaattcagacagaatcttcaaagtttaaaatccagtcgtgttaccattctagttaagctt
tcctgtgagactaatcaggaagtgcactacctgcccggagaacatattgggattttccca
ggcaaccagccagaattagtccatggcctcattgcacatgtcaaggatgcccctccagct
gatcagactatcagacttgaaacctgcactggtggtggctactggacaagtgacaaaagg
attccagcctgcacactccctgaggctttgacatacttgcttgatatcactactccaccc
tcccaacaactgctaaaaaaactctcccagctggtaacagcggaaggagacaaacagaga
ctggaagttttatgtcagagcacggaagaatacaataaatggaagttttacaacagcccg
aacatcctggaggtcctggaggagtttccttctgctgatgtctcaacagctttcttactg
actcagctgccattgctgaaacccaggtactattctgtcagctcctcctgtgacatgaca
cccagagagatccacctgacagttgcagttgtaaactacaggacaagagatggacaaggg
cctttgcaccatggagtttgcagcacatggctgaataccatagctctcaatgaaatagtc
ccatgctttatacgcagtgctaacgggttccagctcccagaggagccaaccaagccatgc
attctgatcggcccaggaacgggaattgctcccttcagaagtttctggcagcagcgtctg
tatgacttggaaaagaaagggatcaaaggtggtgacatgacattattgtttggctgccgg
cagccagacatggatcacatctacagagaagaaactgaggagatgaagaggaagggagtc
ctgaaagaggtgtatacagcttactccagacaacctggccaagctaaagtctacgttcaa
gacattcttcaaagcaagttggacaccaaagtgtgcaacctcttgcataaggaggaaggc
catctgtatgtctgtggagacgtccgcatggccagggacgtggctcagactttgaaaggg
atgcttgcaaaaaagctgaacctcaatgagcagcaggcagaggagtatttcttccagctg
aagagccaaaagcgataccatgaagatatatttggggctgtattcccatatgaagccaaa
agaggtgtaagagctttgcaacccaccagtccaagaacgaatcaactgatgttttag

DBGET integrated database retrieval system