KEGG   Egretta garzetta (little egret): 104122217Help
Entry
104122217         CDS       T05152                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: intestinal-type alkaline phosphatase 1-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00730  Thiamine metabolism
egz00790  Folate biosynthesis
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    104122217
   00790 Folate biosynthesis
    104122217
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104122217
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:egz00537]
    104122217
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     104122217
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104122217
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:egz00537]
 Enzymes
  104122217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 104122217
NCBI-ProteinID: XP_009632610
LinkDB All DBs
Position
Unknown
AA seq 521 aa AA seqDB search
MPPALLSPPDAEKTLNYWNEGARRRLELALALQPAARRAKNIVLFVGDGMGLPTVSAARI
YKGQLAGGLGEESVLXFPHVALAKTYTIDRQVPDSAGTGTAYLCGVKANAKTLGLSGAAV
YGKCRTTFGNEVDSILHRARLAGKSVGIVTTTRVQHASPGAAYAHSASRSWYADTNMPKE
ALRDGCKDIAYQLVHNTDINVILGGGRIYMTPKQTPDPEYPEDSDQNGIRKDGLDLIAKW
LSAKQGARYVWDKKGLDAVEDDSVSHLMGKSITDCATGNTSSSSSPLQGHWWDHEAAPAP
SSVEMTEKAIRILRRNPNGFFLFVEGGRIDHGHHSGRAKQALMEAVMLDRAVARAGELTS
PSDTLTVVTADHSHVFTFGGNTLRGTSIFGLAPKKAKDKRAYTSHXGCTGVGEPAAPSPI
SPACPAEDKDYRQQAAVPLETETHSGEDVVVLAQGPMAHLFHGVQEQHYIAHAMAYAACL
EPYATEPQCRAARRASRGTQCPPPPLLALLTLCMAARLVGG
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagctctgctctcacctccagatgccgagaagaccctgaactactggaatgaa
ggggccaggaggagactggagttggccctggcgctgcagccggcagcacggcgggccaaa
aacatcgtcctcttcgtgggtgatggcatggggctgcccacggtgtcggcggctcggatc
tacaaggggcagctggctggcggcttgggcgaggagagtgtcttgncctttccccatgtg
gccctggccaagacctacaccatcgaccgccaggtgcccgacagcgctggcacaggcacg
gcctacctctgcggggtgaaggccaatgccaagacactggggctgagtggggcagccgtc
tacggcaaatgccgcaccacctttggcaacgaggtggactccatcctgcaccgggccagg
ctggcaggcaagtccgtgggaatcgtgacgaccacacgggtgcagcacgcatcccccggg
gcagcctatgcccactcggccagccggagctggtacgctgacaccaacatgcccaaggag
gcgttgcgggatggctgcaaggacatcgcctatcagctggtgcacaacacagacatcaat
gtgatcttgggaggtgggcggatatacatgacccctaagcagaccccagaccctgagtac
ccggaggactcggatcagaacggcatcaggaaggatggtctggacttgattgccaaatgg
ctgagtgccaagcagggtgcccgctatgtctgggacaagaagggcctggatgcggtcgag
gatgactctgtgagccacctaatgggtaagagcatcactgactgtgccactggcaacacc
tcctcctcctcctccccgctccaggggcactggtgggatcatgaagcagccccagccccc
tcaagcgtggagatgacggaaaaggccattcgcatcctgcgcaggaatcccaatggcttc
ttcctctttgtggaaggtggcaggattgaccacggccaccacagcggccgggccaagcag
gcactgatggaggccgtcatgctggaccgggcggtggcacgggcgggcgagctcacgtcc
ccctccgacactctgaccgtggtgacagccgatcactcccacgtcttcacctttggaggc
aacacgctgcgtggcacctccatctttgggctggccccaaagaaagccaaggacaagcga
gcctacaccagccactgaggctgcacgggggtaggggagcctgctgcccccagccccatt
tctcctgcctgccctgcagaggacaaggactacaggcagcaggcagccgtgcccctggag
acggagacccacagcggggaggacgtggtggtgctggcccagggccccatggcccacctc
ttccatggggtgcaggagcagcactacatcgcccatgccatggcctatgctgcctgcctc
gagccctacgccaccgagccccagtgcagggcagcccgcagggcgtcccgtggcacccag
tgccccccgccacccctgctcgccctcctgaccctctgtatggccgcccgcttggtgggg
ggctga

DBGET integrated database retrieval system