KEGG   Egretta garzetta (little egret): 104122596
Entry
104122596         CDS       T05152                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor NF-kappa-B p105 subunit-like
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04210  Apoptosis
egz04218  Cellular senescence
egz04620  Toll-like receptor signaling pathway
egz04621  NOD-like receptor signaling pathway
egz04622  RIG-I-like receptor signaling pathway
egz04623  Cytosolic DNA-sensing pathway
egz04625  C-type lectin receptor signaling pathway
egz04920  Adipocytokine signaling pathway
egz05132  Salmonella infection
egz05164  Influenza A
egz05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104122596
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    104122596
   04218 Cellular senescence
    104122596
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    104122596
   04621 NOD-like receptor signaling pathway
    104122596
   04622 RIG-I-like receptor signaling pathway
    104122596
   04623 Cytosolic DNA-sensing pathway
    104122596
   04625 C-type lectin receptor signaling pathway
    104122596
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    104122596
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    104122596
  09172 Infectious disease: viral
   05164 Influenza A
    104122596
   05168 Herpes simplex virus 1 infection
    104122596
Transcription factors [BR:egz03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    104122596
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_5
Other DBs
NCBI-GeneID: 104122596
NCBI-ProteinID: XP_009633045
LinkDB
Position
Unknown
AA seq 746 aa
MIWTSKYNRYNGIATIKTNLSLKIIDETIQLFRGRPARKRWQPPGRALRTSLRAKQHGQG
QGYSCGGGNSPGMKPLTDSRGFLQAGGPVPGRGISAPAGLKMAEDSYIIGVSDPQMFAMD
PLMGMNPLFNNTNYITSDLPLRTADGPYLQIIEQPKQRGFRFRYVCEGPSHGGLPGASSE
KNKKSYPQVKICNYVGPAKVIVQLVTNGKYVHLHAHSLVGKFCEDGVCTVNAGPKDMVVG
FANLGILHVTKKKVFETLETRMIDACKKGYNPGLLVHPELGYLQAEGCGDRQLTEREREI
IRQAAVQQTKEMDLSVVRLMFTAFLPDSNGSFTRKLDPVISDAIYDSKAPNASNLKIVRM
DRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEDENGGMWEGFGDFSPTDVHRQFAIVFKT
PKYRDVNITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDGYG
GGNGAGGGGMYGGGGGGAGSGFSYPSYGYSAFGGMHFHPGTTKSNAGMKHGLSNSRAEQD
GKSSDKQSEKWDMKHDVXSGDNEAKEENAASCKTEVNETDCRWQDGPFLEKAMQLAKRHC
NALFDYAVTGDVKMLLAVQRHLTIVQDDNGDNVLHLAIIHLHTELVKNLLEVMPDVNYND
IINMRNDLYQVRCCVWNEPRSDCNVNKFRNAMTYCKVVEEQEHVFTVFVLHLAIIHLHTE
LVKNLLEVMPDVNYNDIINMRNDLYQ
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgatatggacctcaaagtacaacaggtataatggcattgctacgatcaaaactaacctc
agtctcaaaatcattgatgaaacaattcagctttttaggggtcgaccagcgaggaaacgt
tggcagccaccaggccgggcgttgagaacctccctgcgggccaagcaacatggacaagga
cagggttactcctgtggcggcggcaattcccccgggatgaaaccgctcacggattcacgc
ggcttcctccaggccggagggcctgtccctgggagagggatctcggcgccagcgggactt
aaaatggcagaagattcctatattataggagtgtctgatccccaaatgtttgcaatggat
ccgttaatgggaatgaatccattatttaataacacaaattacatcacttcagacttacca
ctacgaacagcagatggaccatatcttcaaatcatagaacagccaaaacagagggggttt
cgtttccgatacgtatgcgaagggccttcgcatggtggacttcctggtgcttctagtgaa
aagaacaaaaaatcataccctcaggtcaaaatctgcaattacgttggacctgcaaaagta
atcgtccagttagttactaatgggaaatatgtccacttacatgctcacagcttggtgggt
aaattttgtgaagatggagtatgcacggttaatgcaggacctaaagatatggttgtaggg
tttgcaaatcttggaatacttcatgtcacaaagaagaaagtgtttgaaactctggaaaca
cgcatgatcgatgcttgcaaaaaaggatacaacccgggactcctggtgcatcctgaactt
ggctatctgcaggcagaaggatgtggagacagacagctaactgaacgagaaagagaaatt
attcgtcaggcagcagtacagcagactaaagaaatggatctcagtgtggtgcgtcttatg
tttacagcctttctccctgacagtaatggtagtttcacacggaaacttgatcctgttata
tcagatgcaatatatgacagcaaagctcccaacgcctccaacttaaaaattgtaagaatg
gacagaacagcagggtgtgtaacaggaggggaagagatttacctcctctgtgacaaggtt
cagaaagatgatatccaaatacgtttctatgaagaggatgagaatggaggtatgtgggaa
ggctttggagacttttctcctacagatgtacatagacagtttgctattgtgttcaaaaca
cccaagtatcgagatgtcaatatcacaaagccagcatctgtatttgtacaactgcgtagg
aaatctgatctagaaacaagcgaaccaaagccttttctctactatccggaaatcaaagat
aaagaagaagtgcaaaggaaacgacagaaactcatgccaaatttctctgatggctatggt
ggaggcaacggcgcgggaggcggtggcatgtatggagggggaggtggcggtgctggctct
gggttcagttatccttcatatggatactctgcttttggagggatgcatttccaccctggc
acaacaaaatccaatgctggaatgaaacacggactatcaaatagcagagctgaacaagat
gggaagagctctgataaacaaagtgagaaatgggacatgaaacatgatgtanactctggt
gataatgaggcgaaggaggagaatgctgcttcctgtaaaactgaagtaaatgaaacagat
tgcaggtggcaggatggtccgttcctggagaaggccatgcagcttgccaagcgtcactgc
aatgctctctttgattatgctgtaactggagatgtgaagatgctgttggctgttcagcgc
catctcactattgtccaggatgataacggagacaatgtccttcatttagcaattatccac
cttcatactgagctggtgaaaaacctgttggaagtgatgcctgatgtgaattacaatgac
atcattaacatgagaaacgacctttatcaggtacgctgttgtgtttggaatgaacccaga
tcagactgtaacgtgaacaagtttagaaatgcaatgacatattgcaaggtggtggaggag
caggagcatgttttcactgtgtttgtccttcatttagcaattatccaccttcatactgag
ctggtgaaaaacctgttggaagtgatgcctgatgtgaattacaatgacatcattaacatg
agaaacgacctttatcag

DBGET integrated database retrieval system