KEGG   Egretta garzetta (little egret): 104122904Help
Entry
104122904         CDS       T05152                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04020  Calcium signaling pathway
egz04114  Oocyte meiosis
egz04140  Autophagy - animal
egz04261  Adrenergic signaling in cardiomyocytes
egz04270  Vascular smooth muscle contraction
egz04310  Wnt signaling pathway
egz04340  Hedgehog signaling pathway
egz04371  Apelin signaling pathway
egz04530  Tight junction
egz04540  Gap junction
egz04910  Insulin signaling pathway
egz04912  GnRH signaling pathway
egz04914  Progesterone-mediated oocyte maturation
egz04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104122904 (PRKACB)
   04310 Wnt signaling pathway
    104122904 (PRKACB)
   04340 Hedgehog signaling pathway
    104122904 (PRKACB)
   04371 Apelin signaling pathway
    104122904 (PRKACB)
   04020 Calcium signaling pathway
    104122904 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104122904 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    104122904 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    104122904 (PRKACB)
   04540 Gap junction
    104122904 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104122904 (PRKACB)
   04912 GnRH signaling pathway
    104122904 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    104122904 (PRKACB)
   04916 Melanogenesis
    104122904 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104122904 (PRKACB)
   04270 Vascular smooth muscle contraction
    104122904 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104122904 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:egz03019]
    104122904 (PRKACB)
   03036 Chromosome and associated proteins [BR:egz03036]
    104122904 (PRKACB)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     104122904 (PRKACB)
Protein kinases [BR:egz01001]
 Serine/threonine kinases: AGC group
  PKA family
   104122904 (PRKACB)
Messenger RNA biogenesis [BR:egz03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     104122904 (PRKACB)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104122904 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 104122904
NCBI-ProteinID: XP_009633387
UniProt: A0A091IX21
LinkDB All DBs
Position
Unknown
AA seq 398 aa AA seqDB search
MAAPKEVPCNQCPGTATALQRLEGFANRLFHRHSKSGAHEQRAALENESQHCSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctccgaaggaggtaccttgtaaccagtgcccagggacagccacggcgctgcag
agactggaaggttttgctaatcgcctcttccataggcattcaaagagtggcgcgcatgaa
cagagagcggctctggaaaacgagagccaacattgctcggaacttgctgtcctgtgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagaggcaaaaaacccttggaacagga
tcatttgggagagttatgatggtgaaacataaatccacagaacagtattatgctatgaag
atactggacaaacagaaggttgtcaaactgaagcaaatagaacacacactgaatgagaag
agaatattacaagcagtgaactttcccttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgagatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcggtggactggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccgtcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacgatacggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaagct
ccgttcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system