KEGG   Egretta garzetta (little egret): 104123260Help
Entry
104123260         CDS       T05152                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egz00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104123260 (SETD2)
Enzymes [BR:egz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104123260 (SETD2)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104123260 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET SRI WW
Motif
Other DBs
NCBI-GeneID: 104123260
NCBI-ProteinID: XP_009633790
LinkDB All DBs
Position
Unknown
AA seq 2574 aa AA seqDB search
MVIPAEGLFLRTAHRLNYPEPLLGADEATKSLRVQRKAAARAADFSAKSEALRRSLVVMI
KRYRGITWQRLLTLCRRGRVKRDRPHRITTADAGKPETVQKAGFIKGPVFKGIASSRFLP
KGTKTKVNLEEQGRQKVSFSFSLTKKTLPNRFLTGLGNEKQNEAQNSPAVPLQTDFNPKS
KMDLGDAAGSAEESSPPKPKVELGKIHFKKHLLNVTAKPPPAPAATLPPPPQAVAPEPCH
AVPKEALELDIKQDAVSQERLTQNTEQTEITPQKEDSHIGKEDEVSDGSKGAPLCSRRQG
SKRKFSQSDGTVLGSESDEDSVRTSSSQRSHELKISSTEKERDPRRSSASLRGDDLGKSS
SRSKSDRDEKYSSYSKSERDSRYTSSRSRSDRERRRSRSHSRSRSDRGSRTSSSYSRSER
SHYYESDRRYHRSSPYRERSRYSRSYADSRARESSDSEDEYRRTHSRSSDSRRTSSHSSS
SYRDSRTSYSKSDRDSKVESSHADVERRGRSSSKADRDSKRTSESEVTKRCSPLDELGYR
KGTSHSKPDSNVNSSRYKSTPSKTPAPKPDKFKSSFCCTESIEEIKQQSNSLDLETSCLK
SNEIRVAIAKKFEREKTLSPLKQLNDLPTCKKADESKAGFANSESEELAGNECHDSVKEQ
ETLLKIKHDQLRTCFPMELSVNGSPEGRADGLATSSASKTEDFAASSEDSLHRSEASPVV
KTSPSYPLPSNGFESTYASQEQEPDDSRVHSSECDSLFRQAEAPVPQQQGEASPLPIMNV
EHTKTVLKKLDDQATLCDKTKEPVFCYISDDATPALYHSEVEIEAEPADLKVTSETFLDM
QVEPQTVTCDYESTEDHHSKSACDFDEHDHPSHKISLAVESSSRDPSQDGCSPRLRSDHP
VPEESVSSKWDVAPPDGHQELVQRLEAEEVLELDTQHIDLGSAKSKPLFKDEHSYYSEMP
LEHRGGEVAEESAVSTKGVGPDDLRVRCPSVLAKKDEGNEPLVASAFPGALFPSCDVIVT
AEEMETVTQAPTCDSSGNAAEFVPTGHDDYSDMGESDSEGRSEDSDTEGSDSDDGAPRKR
LQSVVIVPKNSTIAMEENSPGSSRSSQGNRRFSDHWDDERPESSRPYYEERLENMATKGG
PQVESRCSPRGMEKSPATSTELSRXXXXXXXXGLRQDPCQPQSDGVDSTSQADLMADSHG
KPNPDERIMLKELMAVGRPIGRQDEQPFCLPESFESEDKSRHQMSSSKPDSRQGKGGLNQ
SGLGDFSRLDGFQTTEDMGGLGWDFSQPEKPSSTYQQPDSSFGVYSGYVYQPGSGAYSGS
QSYWQGNGYWDARSASRPSAVNYERIQGQVPDSLTEDHEEYEEDDRWDDDCKPRFPSPSS
KCQVPGQKEKGSVQAHEISSNSTKEPVPGGEKKEEVKVFEKNDVKERGPPKKRRPELESD
SESDVDSREKKKVKPEGEQVESAPQDSSMVGRLCIMDDFRDPQRWKEFAKQGKMPCYFDL
IEENVYLTERKKNKSHRDIKRMLCECPPLSKEERAQGEVACGEDCLNRLLMIECSSRCPN
GDYCSNRRFQKKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKE
YARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKL
VPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSV
DGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLECHG
LSLLWIWMTELGDGRGSTANNLKLQLEIMKTLELLPIPTKNMLEESKVLPIIQRWAQTKT
AVPQLSEGDGYSSENTSRAHTPLNTPDLSTKQSAEGDTDTPKKLVFRRLKIISENSMDSA
ISDTTSELEGKEGKEDLDQLEGAPMEVSEEQQQQQEIKATVDAPVESSKPQAAELETEPE
AEVKESNGAKLEEPITMETPSQDEEEGVSDVESERSQEQTDKIVDVSDLATRLLDSWKEL
KEVYRIPKKSQAEKENTDRGRETAGLRDQTPTPKNPILSRERDPERQSQSKEKKRRRDSL
SPPSSAYERGTKRPEDRYDTPASSKKKVRLKDRNKLSTEERRKLFEQEVAQREAQKQQQQ
LQNLGMTSPLPYDSMGYGTPHHSFIGYPPGYPMQAYVDPSNPNAGKVLLPTPTMDSMCSP
AAYEHPQTLVGHTVEPTLTTPQPVPVVQHVATTMEVTTPQYVAQSDTVVHQEPNVAVLPV
AAPGPVQSQSYGVWDSSQQTVAVQQQYSPAQSQPAIYYQGQTCQTVYGVTSPYSQTTPPI
VQSYAQPGLQYIQGQQIYTAHPQGVIVQPPTAVTTIVAAGQPQPIQQPELVVTNNLLDLP
PPSPPKPKTIVLPPNWKTARDPEGKIYYYHVVTRQTQWDPPTWDSPGDDASLEHEAEMDL
GTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEVSVPNAPRGGRGVSPSHADEVW
GLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAIYKPKEDTDLE
NT seq 7725 nt NT seq  +upstreamnt  +downstreamnt
atggtgatacctgctgaaggtctgttcctgcggacggcacacagacttaattacccagag
ccattgctgggggcagatgaagccacaaaatctctgcgtgtccagcggaaagcggcggcc
cgagctgccgacttctctgccaagagtgaagccctgcgccggtcactggtagtaatgatc
aaacgttaccggggtataacctggcagcgcctgctgacgctgtgccgccgcggtcgagtc
aaacgtgaccgtccccaccggattacgacggcagacgccggcaagcctgaaaccgtgcag
aaagctggctttatcaaaggcccagtgttcaaaggcattgcttcgagtcgctttttgccc
aaaggcaccaaaacaaaggttaaccttgaggagcaaggaagacaaaaggtgtctttcagc
tttagtttaaccaagaaaaccttaccgaatagatttctgactggtctcggaaacgagaaa
caaaatgaagctcagaactctccagcagtaccccttcagactgactttaaccccaaaagt
aaaatggacctgggggatgccgctggttcagctgaggagtcttcacctccgaaaccgaag
gtagaattagggaagatccattttaaaaaacatttacttaatgtcacagcaaaaccgcca
ccagctccagcagccacgctaccgccaccgccgcaggctgtggcaccggagccgtgccac
gcggtaccgaaggaggctttggagctggatatcaagcaggatgcggtatcgcaagagcgt
ctaactcaaaacacagagcagacggaaataactccgcagaaggaagattcccatattggg
aaagaggatgaggtttccgacggctcgaagggtgctcccctctgctcccggaggcagggg
tcgaagaggaagttctcccagtctgacggcacagtgctgggctctgagtccgacgaagat
tcggtgaggacctcctccagccagcggtcacacgagctgaagatatccagtacggagaag
gagagagatcccagaagaagctctgcgtccctcagaggtgacgacctggggaagtcctcc
tcgcgctccaagtcggacagggatgagaagtactcgagctattcaaaatcggaaagagat
tcgcggtatacgtcctcccgctctcgatcagacagagagagaaggcgaagccggtctcat
tcccgttcccgatccgatcggggctcccgaaccagctcttcctactcgaggtcggagcgt
tcgcattactacgaatccgaccgcagataccatcggagctccccgtacagggaaaggtcg
agatattcccgttcgtatgcggacagcagggcgcgagagagctcggactcggaggacgag
tacaggaggacacattccagatcgagcgactcgaggcgtacgtcgtcccactcctcctcc
tcctacagagactcgaggacttcttactctaagtcggacagggacagcaaagtagagtcg
tctcatgccgacgtggagaggagaggaaggtcttcttcgaaagcagatagagattctaaa
aggacttcagaaagtgaagtaaccaaaaggtgctctccccttgatgagctaggctatcga
aaggggacatcccattctaagcccgacagtaatgtgaattcctcccgttataagtccacc
ccttcaaagacccccgcaccaaagcctgacaaatttaagagttctttctgttgtacagaa
tcgattgaagaaataaaacagcagtctaattctctagatttagagacctcttgtctaaaa
agcaatgagatcagggtagccattgcgaaaaagtttgaaagggaaaagacactttctccg
ttaaagcagttaaacgatttgcccacttgcaaaaaggcagacgaatcgaaagcgggtttt
gctaactcagagtccgaggagcttgcaggaaacgaatgccacgacagtgttaaggagcaa
gaaactttattaaagataaagcacgatcagttaagaacgtgtttccccatggagctgagt
gtaaatgggtccccggaaggtagggctgatggtttggcaacttccagtgcctccaaaaca
gaggatttcgctgcctcttctgaggatagcctgcatcggtcagaagcgtcgcctgtcgtg
aagacgagtccgtcgtatccgttgccatctaatgggtttgagagcacgtatgcgtctcag
gagcaagagccggacgattcccgggtccactccagcgagtgcgacagtctgtttaggcaa
gcggaggctccggtcccgcagcagcaaggggaagccagccctttgcccatcatgaatgta
gaacatactaaaactgtacttaagaagctggacgatcaggcgactctgtgtgacaaaacc
aaagaaccagttttttgctacatttcagacgatgccacccctgctttgtatcattcagaa
gttgaaatcgaagcagaaccagcagatttaaaagttacatccgagactttcctggacatg
caggtagagccgcagactgttacttgcgattatgagagtacggaggatcaccactcaaag
tctgcctgtgactttgatgagcatgatcatccttcccataaaattagcctggcagtggag
agctccagcagggatccttcccaggatggctgttccccaaggctcaggtcagatcatccc
gtgccggaggaaagcgtctcttccaaatgggacgtggcaccaccagatggacaccaggag
ctggtgcagcgtttggaagctgaagaggtgctcgagttggatacgcagcacattgatctt
ggttcggcaaaaagcaagccattgttcaaagatgaacattcgtactattcagaaatgccg
ctggagcaccgtggcggagaggtcgcggaagaaagtgctgtttccaccaagggagttggg
ccagatgatttgagagttcggtgtcccagcgtattggccaagaaggatgagggaaacgag
cccttggtggcttcagcttttccaggcgccttgtttccctcttgcgatgtcattgtcact
gcagaagaaatggagacggtaactcaagcccctacgtgtgacagcagtggcaacgccgct
gaatttgttcccactggccacgacgattactctgacatgggggagagtgacagcgagggg
cgcagtgaagatagtgacacggaaggctcggattctgatgacggtgcgccacggaaacgg
ctccagtctgttgtgatcgtaccaaaaaactcgaccattgcgatggaggagaacagccct
ggctcctcacggagcagccagggcaacaggcgcttctccgaccactgggacgatgagcga
ccggagtccagtagaccctactatgaagagagattggagaatatggcaactaaaggtggt
ccacaagtagagagcagatgttctcctagagggatggagaagagtccggcaacttctact
gagctcagcaggnnnnnnnnnnnnnnnnnnnnnnntggcctgcggcaggacccgtgccag
cctcagagcgacggtgttgacagtacgagtcaggcagacctgatggcagactcccatggc
aaacccaacccagatgagagaataatgttgaaggagctgatggccgttggtagaccgatt
ggccgacaagacgagcagccattttgtctgccggagagttttgaaagcgaggataaatcc
cgacaccagatgagctcttccaagccagacagtaggcaagggaagggtgggcttaaccag
tctggcctcggtgacttctccaggttggacggttttcagacgacggaggatatgggtggt
ttgggctgggacttttcccagccggagaagcccagtagcacctaccagcagccagatagc
agcttcggggtctactcaggctacgtttaccagccgggctcaggagcgtacagtggctct
cagagttattggcaaggcaacggttactgggacgcgaggtctgctagcagaccttctgca
gttaattacgaacgaattcaagggcaggtaccggattctctaacagaggatcacgaggag
tacgaagaggatgaccgttgggatgatgactgcaagcctcggtttcccagcccctcgagt
aaatgccaggtgcccgggcagaaagaaaaaggctcggtgcaggcgcatgagatcagcagc
aactccaccaaggagccggtgcctggcggggagaagaaggaggaggtgaaggtttttgaa
aaaaatgacgtgaaagagcgaggcccaccaaaaaaaagacgcccagagttggagagcgac
tccgagagcgacgtggactcgagggagaagaagaaggtgaaaccggagggggagcaagtg
gagtcggcgccacaggactcctccatggtcggtcggttgtgcatcatggacgacttcaga
gacccccagcgctggaaggagtttgccaagcaaggaaagatgccctgttactttgacctt
attgaggagaatgtgtacttgacagaaaggaagaagaacaaatctcaccgggatatcaag
cgaatgctgtgcgaatgcccgcctctctccaaagaagagcgagctcagggggaggttgct
tgtggagaagactgtctcaatcgcctgctcatgatagagtgttcttccaggtgcccaaat
ggcgactactgctccaacaggcgcttccagaagaaacagcatgccgatgtggaagtgatc
ctcacggagaagaaaggctgggggctgagagctgccaaagacctgccatccaacactttc
gtcttggagtactgcggagaagtgctggatcacaaagagttcaaggctcgcgtgaaggag
tatgcccggaacaagaacattcactattatttcatggccctgaagaacgatgagataatc
gatgctacccagaaaggaaactgctctcgttttatgaaccacagctgtgaaccaaactgc
gagacacaaaagtggactgtgaatgggcagctcagagttggatttttcaccaccaaactg
gtcccgtcgggctcggagctgacgtttgattaccagttccagagatacggcaaagaggct
cagaaatgtttctgcggctcggccaactgccggggttacctgggaggagagaacagggtc
agcatccgagccgccggggggaaaatgaagaaggagcgctcccgtaagaaggactcggtg
gacggggagctggaagcgctgctggagaatggagagggtctctccgataagaaccaagtc
ctcagcttatcccggctgatggttcggatcgaaactctggagcagaagctcacctgcctc
aaactcatacagaacacgcactcgcagtcctgcctgaagtccttcctggagtgtcacggc
ttatctctcctctggatttggatgacggagctgggcgatgggagaggaagcaccgctaac
aacctgaagttgcagctggagataatgaagacactagagctcctgcctatacctaccaag
aacatgctggaggagagcaaagtgcttcccattattcagcgctgggctcagaccaagacc
gctgtcccgcagctcagcgaaggggacggctactccagcgagaacacctcgcgggctcac
acgccgctcaacacgccagatctttccaccaagcagagcgcggaaggtgacacggacacc
ccgaagaagctggtatttcgaaggctgaaaattataagtgaaaacagcatggacagtgcc
atctctgatacgaccagtgagctggaagggaaggagggcaaagaggacctggaccagctg
gagggtgccccgatggaggtgtcagaggagcaacagcagcagcaggagatcaaagctacc
gtcgatgcgccggtggagagcagcaaaccccaagctgctgagctggagactgagcctgaa
gcagaggtcaaagagagcaacggggcgaagctggaagagcccattacgatggaaacgcca
tctcaagatgaagaggaaggcgtctcggacgtcgagagtgagagaagccaagaacaaacg
gacaaaattgtggatgtgagcgatttggctaccaggctgcttgacagctggaaggagctc
aaggaggtttaccggatcccaaagaagagtcaagcagaaaaggagaacactgaccgtggg
agagagacagccggcctccgggatcagactcctactccgaagaaccccatcctgagcaga
gagcgggatcctgagaggcagagccaaagtaaagagaagaagagacggagagactcgttg
tcccctccgtcctcggcgtacgagcgaggaacgaagaggccggaggacaggtatgacaca
ccagcgtcttcgaagaagaaagtccggcttaaggatcgcaacaagctgtccacggaggag
cgcaggaagctgtttgagcaggaggtcgcccagcgggaagctcagaaacagcaacagcaa
ctgcaaaacctgggaatgacgtcccccctgccttacgactccatgggctatggcacgccc
caccacagctttatcggctacccgcctggctaccccatgcaagcctacgtagaccccagc
aaccccaacgctggcaaggtgctgctgcccacgcccaccatggattcgatgtgctcgccg
gcggcgtacgagcacccgcagactttggttgggcacacggtggaaccaaccctaactact
cctcagcccgtacccgtagtccaacatgtagcaacgacgatggaggttacaactccgcaa
tatgtagcacaaagcgacaccgtggtccatcaagaacccaatgtggccgtcctgcccgtg
gccgcaccgggaccggtgcagagccagagctacggggtctgggattccagccagcagact
gtagctgtacaacagcagtactcaccagcccagtcccaaccagccatatattaccaagga
cagacctgtcagactgtttacggtgtgacatccccctactcgcagacgactccaccgatt
gtacagagttacgcccagccaggtctccagtacatccagggccagcagatttacacggct
catccacagggagtcatagtgcagccaccgacagcagtaactacgatcgttgcagccggg
cagcctcagcccatccagcagccagagctcgtggtgaccaataacctcctggacttgcct
cctccatcccctccaaaacccaaaacgatcgtccttccacccaactggaaaacagcccga
gatccagagggaaagatctactactaccacgtggtaacaagacaaacccagtgggaccct
cctacctgggacagcccaggggatgacgccagccttgaacacgaagctgaaatggacctc
gggaccccaacgtacgatgaaaaccccatgaagtcttccaagaagcccaagacggcggaa
gcggacacgtcgagcgagctggccaagaagagcaaggaggtgttcaggaaagaagtgagc
gtccccaatgccccgcggggggggaggggggtgtcaccgtcccacgccgacgaggtttgg
gggctgactcatggcgtcatgaacaaggagctgaaatactgcaagaacccggaggacctg
gagtgcaacgagaacgtgaagcacaagacgaaggagtacatcaagaagtacatgcagaaa
tttggggccatctacaaacccaaagaggacacggacctggagtaa

DBGET integrated database retrieval system