Egretta garzetta (little egret): 104123569 Help Entry 104123569         CDS       T05152                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism egz  Egretta garzetta (little egret) Pathway egz04010   MAPK signaling pathway egz04012   ErbB signaling pathway egz04068   FoxO signaling pathway egz04137   Mitophagy - animal egz04140   Autophagy - animal egz04144   Endocytosis egz04150   mTOR signaling pathway egz04210   Apoptosis egz04218   Cellular senescence egz04370   VEGF signaling pathway egz04371   Apelin signaling pathway egz04510   Focal adhesion egz04540   Gap junction egz04625   C-type lectin receptor signaling pathway egz04810   Regulation of actin cytoskeleton egz04910   Insulin signaling pathway egz04912   GnRH signaling pathway egz04916   Melanogenesis egz05132   Salmonella infection Brite KEGG Orthology (KO) [BR:egz00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104123569 (HRAS)    04012 ErbB signaling pathway     104123569 (HRAS)    04370 VEGF signaling pathway     104123569 (HRAS)    04371 Apelin signaling pathway     104123569 (HRAS)    04068 FoxO signaling pathway     104123569 (HRAS)    04150 mTOR signaling pathway     104123569 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104123569 (HRAS)    04140 Autophagy - animal     104123569 (HRAS)    04137 Mitophagy - animal     104123569 (HRAS)   09143 Cell growth and death    04210 Apoptosis     104123569 (HRAS)    04218 Cellular senescence     104123569 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104123569 (HRAS)    04540 Gap junction     104123569 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104123569 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104123569 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104123569 (HRAS)    04912 GnRH signaling pathway     104123569 (HRAS)    04916 Melanogenesis     104123569 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104123569 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:egz04131]     104123569 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:egz04147]     104123569 (HRAS)    04031 GTP-binding proteins [BR:egz04031]     104123569 (HRAS) Membrane trafficking [BR:egz04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104123569 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104123569 (HRAS) Exosome [BR:egz04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104123569 (HRAS)   Exosomal proteins of colorectal cancer cells    104123569 (HRAS) GTP-binding proteins [BR:egz04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104123569 (HRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  104123569 NCBI-ProteinID:  XP_009634132 UniProt:  A0A091JP66 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatataagctggtggtggtgggagctggtggtgtcgggaagagtgctttgaca atacagctcattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacatgcttgttagacatcttggatactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacgggggaaggattcctctgc gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagacgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcgcaggacctggcccggagttatgggatcccc tacatagaaacatctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccggatgagagtggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system