KEGG   Egretta garzetta (little egret): 104123983Help
Entry
104123983         CDS       T05152                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
egz  Egretta garzetta (little egret)
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin PepSY_2
Motif
Other DBs
NCBI-GeneID: 104123983
NCBI-ProteinID: XP_009634580
LinkDB All DBs
Position
Unknown
AA seq 159 aa AA seqDB search
MQFSGRWFLVSVASRCSYLAEHSHQLEATAVTMTVLEGQSLAISTFRKLDGMCWEIRQRY
LPAQAHGRFLLKGRGYRSKVDVVVGETDHSSYAILYYQKGRSISVKLYGRTSQVSDAVMD
KFEQRVRAVGLSEDVTYYFPTYGFCDSADEFHILDAMRH
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgcagttctcagggaggtggttcctggtcagtgtggcctcccgctgcagctacctggca
gagcacagccaccagctggaggccacggcagtgacgatgacggtcctggaggggcagagc
ctggccatcagcaccttcaggaaactggatgggatgtgctgggaaatcaggcagcgctac
ctccctgcccaggcccacggacgcttcctcctgaagggccgtggctaccgcagcaaggta
gatgtggtggtgggtgagacggaccacagcagctatgccatcctctactaccagaaggga
cggagcatctctgttaagctctatggacggaccagccaggtcagcgatgctgtcatggac
aagtttgagcagcgcgtcagggccgtgggcctgagcgaagatgtcacctactacttcccc
acgtacgggttttgtgactccgcagacgagtttcacatcctcgatgccatgagacactga

DBGET integrated database retrieval system