KEGG   Egretta garzetta (little egret): 104124192
Entry
104124192         CDS       T05152                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04012  ErbB signaling pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104124192
   04068 FoxO signaling pathway
    104124192
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124192
   04115 p53 signaling pathway
    104124192
   04218 Cellular senescence
    104124192
SSDB
Motif
Pfam: CDI Coat_F
Other DBs
NCBI-GeneID: 104124192
NCBI-ProteinID: XP_009634799
LinkDB
Position
Unknown
AA seq 133 aa
MEWRLGKTTHVRRNLFGPVDHEQLRQDFQHMLHHSVEGAQQKWNFDFLQDTPAEGLLQWE
ELKGHEVPAFYHSCMVGDARRPLQHLNWPLGREDESHGFAQVALTEKPKTSKKTGGKRSS
EGKKRKQTSLTGL
NT seq 402 nt   +upstreamnt  +downstreamnt
atggagtggaggctggggaagacgacccacgtccggaggaacctctttggccccgtagac
cacgagcagctgcggcaggacttccagcacatgctgcaccacagcgtcgagggggcccag
cagaagtggaacttcgatttcctccaggacacgccggcggagggccttctgcagtgggaa
gagctcaagggccatgaggtgcctgccttctaccacagctgcatggtgggagatgctcgg
agaccactgcagcacttaaactggcccctgggcagggaggacgagagtcacggctttgcc
caggtggcactgactgagaaacccaaaacttccaagaaaactggggggaagaggagctcg
gaagggaaaaagaggaaacagacgtcgttgacaggtttgtga

DBGET integrated database retrieval system