KEGG   Egretta garzetta (little egret): 104124225
Entry
104124225         CDS       T05152                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04012  ErbB signaling pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104124225 (CDKN1B)
   04068 FoxO signaling pathway
    104124225 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124225 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104124225
NCBI-ProteinID: XP_009634834
LinkDB
Position
Unknown
AA seq 183 aa
MEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKWNFDFQNHKPLEGRYE
WQAVEKGSSPDFYFRPPRLLKAVCKSAGRQSLDVNGNCQTVVFVGSQGISEDTHCVGQKT
DVSENQTDFAEQCTGQRKRPATDDSSPQNKRANTTEEEVSEDSPSASSVEQTPKKSSPRR
HQT
NT seq 552 nt   +upstreamnt  +downstreamnt
atggaagcccggcagtcggagtacccgaagccgtcagcttgcaggaacctcttcgggccg
gtgaatcacgaagagttaaacagggacttgaagaagcaccgccaggagatggaggaggca
tgccagaggaagtggaatttcgatttccagaatcacaagccgctggaaggcaggtacgag
tggcaagccgtggagaaggggagctcgcccgacttctacttcagaccccctaggctactg
aaagctgtctgcaagtccgccggccgccagagcttggatgtaaacgggaattgccaaacc
gtggtttttgtcggttctcagggaatctcagaggacactcactgtgtaggtcaaaagact
gatgtttctgaaaatcagacggactttgcagagcagtgcactgggcagaggaaaagacct
gccaccgatgattcctctcctcaaaataaaagagccaacacaacagaagaagaggtttca
gaagactcccccagtgccagttcagtggagcaaacgcccaagaaatcaagcccaagaaga
catcaaacgtaa

DBGET integrated database retrieval system