KEGG   Egretta garzetta (little egret): 104124226
Entry
104124226         CDS       T05152                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04012  ErbB signaling pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104124226
   04068 FoxO signaling pathway
    104124226
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124226
   04115 p53 signaling pathway
    104124226
   04218 Cellular senescence
    104124226
SSDB
Motif
Pfam: CDI Coat_F
Other DBs
NCBI-GeneID: 104124226
NCBI-ProteinID: XP_009634835
LinkDB
Position
Unknown
AA seq 153 aa
MEWRLGKTTHVRRNLFGPVDHEQLRQDFQHMLHHSVEGAQQKWNFDFLQDTPAEGLLPWE
ELKGHEVPAFYHSCMVGDARRPLQHLNWPLGREDESHGFAQVALTEKPKTSKKTGGKRSS
EGKKRKQTSLTDYYLVKKRVKTNMEATTKKSTS
NT seq 462 nt   +upstreamnt  +downstreamnt
atggagtggaggctggggaagacgacccacgtccggaggaacctctttggccccgtagac
cacgagcagctgcggcaggacttccagcacatgctgcaccacagcgtcgagggggcccag
cagaagtggaacttcgatttcctccaggacacgccggcggagggccttctgccgtgggaa
gagctcaagggccatgaggtgcctgccttctaccacagctgcatggtgggagatgctcgg
agaccactgcagcacttaaactggcccctgggcagggaggacgagagtcacggctttgcc
caggtggcactgactgagaaacccaaaacttccaagaaaactggggggaagaggagctcg
gaagggaaaaagaggaaacagacgtcgttgacagattactacttggtgaagaagcgagtc
aaaacaaatatggaagctactacaaagaagtcaacttcttga

DBGET integrated database retrieval system