KEGG   Egretta garzetta (little egret): 104124248Help
Entry
104124248         CDS       T05152                                 

Gene name
ALDH7A1
Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00010  Glycolysis / Gluconeogenesis
egz00053  Ascorbate and aldarate metabolism
egz00071  Fatty acid degradation
egz00260  Glycine, serine and threonine metabolism
egz00280  Valine, leucine and isoleucine degradation
egz00310  Lysine degradation
egz00330  Arginine and proline metabolism
egz00340  Histidine metabolism
egz00380  Tryptophan metabolism
egz00410  beta-Alanine metabolism
egz00561  Glycerolipid metabolism
egz00620  Pyruvate metabolism
egz01100  Metabolic pathways
Module
egz_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104124248 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    104124248 (ALDH7A1)
   00620 Pyruvate metabolism
    104124248 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104124248 (ALDH7A1)
   00561 Glycerolipid metabolism
    104124248 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    104124248 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    104124248 (ALDH7A1)
   00310 Lysine degradation
    104124248 (ALDH7A1)
   00330 Arginine and proline metabolism
    104124248 (ALDH7A1)
   00340 Histidine metabolism
    104124248 (ALDH7A1)
   00380 Tryptophan metabolism
    104124248 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104124248 (ALDH7A1)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     104124248 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     104124248 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     104124248 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 104124248
NCBI-ProteinID: XP_009634861
LinkDB All DBs
Position
Unknown
AA seq 482 aa AA seqDB search
MNYENVLHMEIKYCVSDHXPIRCRQASLEDYEETVKKAKEAWKVWADIPAPKRGEIVRQI
GDALRQKIKVLGSLVSLEMGKIFVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHA
LIEQWNPVGLVGIITAFNFPVAVYGWNSAIAMICGNACLWKGAPTTSLISVAVTKIIAKV
LEDNKVPGAICSLVCGGADIGTAMARDERMDLLSFTGSTKVGKQVALMVQERFGRSLLEL
GGNNAIIVFEDADLNLVIPSALFAAVGTAGQRCTTARRLFLHESIHDEVVAKLAKAYAQV
RIGDPWDSDTLYGPLHTKEAVKMFLDAVEQAKQQGGSVVCGGKVINRPGNYVEPTIVTGL
PHNAPIVHTETFAPILYVLKFKEEEEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPKGSD
CGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIK
FQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaactatgaaaatgtcttacacatggaaataaagtactgtgtatctgatcactaacca
atacggtgcagacaagctagtttggaggattatgaagaaacagtaaagaaggctaaagag
gcatggaaggtctgggctgacatccccgcacctaagcgtggagaaatagtgcgacagatt
ggtgatgccctgagacaaaaaatcaaagttctaggaagcttggtctctttggaaatggga
aagatttttgttgagggtgttggggaagtgcaggagtatgttgatgtctgcgactatgct
gttggtttgtcccgaatgattggcggacctattttgccttcagaaagacctggccatgcc
cttatagagcagtggaatcccgttgggttagtaggaatcatcacggcctttaacttcccc
gtagcagtttatgggtggaacagtgcaattgcaatgatctgtggaaatgcttgcctctgg
aagggtgctcctacaacatccctcattagcgttgctgttacaaagataattgccaaagtc
ttggaggataacaaagtgcctggagcaatctgttctctggtttgcggtggagcagacatt
gggacagcaatggcgagagatgagagaatggacctgttgtccttcactggcagcacgaaa
gtgggcaagcaggtagcactcatggttcaggagagatttggtcgaagtctgctggaactg
ggaggaaacaatgccattattgtgttcgaagatgcagacctgaacctagtcatcccatct
gctctatttgctgctgtgggaacagcgggtcagaggtgcacaactgctagaaggctgttc
ctccatgaaagcatccatgatgaggtggtggcaaagcttgctaaagcctatgcccaggtc
cgcatcggtgatccatgggattctgacactctgtatgggcctcttcataccaaagaagca
gtgaaaatgttccttgatgcagtagaacaagcaaaacaacaaggtggctctgtggtctgt
ggtggaaaggttataaatcgccctggaaactatgttgaaccaaccattgtgactggcctt
cctcataatgcacccattgtccacactgagacatttgcccccatactgtatgtgctgaag
tttaaggaggaagaggaggtttttgcctggaataatgaagtaaaacaaggtctttccagc
agtatttttaccaaagatttgggaaggattttccgctggcttgggccaaagggatctgac
tgcggcattgtgaatgtcaacatcccaaccagtggggctgagattgggggtgcttttggt
ggtgaaaagcacactggtgggggaagagaatctggaagtgattcatggaaactttatatg
agacggtctacttgtacaatcaactacagcaaggatttgcctttggctcaaggaatcaag
tttcagtaa

DBGET integrated database retrieval system