KEGG   Egretta garzetta (little egret): 104124442Help
Entry
104124442         CDS       T05152                                 

Gene name
POLRMT
Definition
(RefSeq) DNA-directed RNA polymerase, mitochondrial
  KO
K10908  DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:egz03029]
    104124442 (POLRMT)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     104124442 (POLRMT)
Mitochondrial biogenesis [BR:egz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    104124442 (POLRMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RNA_pol RPOL_N PPR_3 PPR_2
Motif
Other DBs
NCBI-GeneID: 104124442
NCBI-ProteinID: XP_009635075
LinkDB All DBs
Position
Unknown
AA seq 1259 aa AA seqDB search
MHGAGGCSPWAGAFTRHRPAGIAGIACLGALVPSSGEDGVEMALGQRISWSVLRNYSSAS
AKEKARRNVVCERTELLEVLKARVKQLQASNVPEVMVNKVELAPLGNDKYQDPLQKVVAP
SPAEDQLTPRGRDESPAQPRSWVEKLKKEMYIRQLKVERKLSIAASKLALEGQAKAKPKG
KVKAKAKATKQLKNPKAKVAAAWSQSHVGPRGVYAHSKPRVAAAKKVAKVQRSQRVREGK
DSSQYKILQQTIQSNLECFLFLQQPEEAERFLLLYHSSPVKRRLLNVNAYNIVMRSWARK
GCLQRINRLFSMLESIGLQPSLDSYAAALECMGRNQSSAKAIQGCLQKLKNDGFHVDELF
QKCLFEEDEKEKVLRAIRIVQPNYQLPPPPTPQTCKSSLLQDFYSREKMVSYPKLDFSVQ
ELKERFQQQLEMEVDNTITIESVESAKPLTPQAIKARKLLDTLRSQWHGSILQALQKSKH
SMSKLKMVSGYNILYPYLCLLPDEEYVGIMLQILNSLSPQGESLAVLARDLGSKVYNRYI
TQRKLRSRQLEKVQEVYEGYIHLLAKDSQPDEYLPREYWEKLVMEAGFGPSLNLKDCSWP
YMLLMRLGMHMLELLVKAVKVPRNILNPRLEPKLIPVLYHIYSFHSSWQVGLIKPHPIFS
QIVSDAAETLLTFNSSAIPMLCPPVPWTSPHFGAFILNDTKLMRFVDGVIQHQLLLEQCP
PVNLHPVLDALNQLGNCAWKINQPVLDIIISIFNDKGNEKLDIPPPISEAPRPSAASSNS
SAWNKSQKHELLLCKKKAAEMHSLRMDALYKLSIANYVRDKVFWFPHNMDFRGRTYPCPP
YFNHLGNDVTRAILLFAEGRPLGPKGLDWLKIHLINLTGLKKKNALQERLEYANEIMEEI
LDSADHPLTGRKWWMNTDEPWQALACCMEIAKASRSPDPAAYISHFPVHQDGSCNGLQHY
AALGRDLIGATSVNLMPCSVPQDVYSAVAQQVEEFRKKDAERGVKIAQVLQGFISRKVVK
QTVMTVVYGVTRYGGRLQMEKRLKEIDEFPEEYLWEASHYLVKQVFNGIKEMFSATRDIQ
NWLTESAKLIAQSGQTVEWVTPLGLPIVQPYYRSRSTVLNCGMQNLSVKTSNSNQKPDTV
KQKNAFPPNFIHSLDSTHMMLTALHCLRQGLTFVSVHDCYWTHALTVDVMNQICRQQFVA
LHSEKILQDLSEFMLEKYCSPGRETRALWQKKLMEQLSNVPKTGEFNLKKVMDSTYFFS
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atgcacggcgcagggggctgcagcccctgggcaggggctttcaccaggcatcgccccgct
ggcatcgctggcatcgcctgcctgggggcactcgtgccctcgtcaggagaggatggggtg
gaaatggcactggggcagcggatctcatggagtgtcctcaggaactactcctctgccagt
gccaaggagaaggcgaggagaaatgtcgtctgtgagaggacggagctgctggaagtgctg
aaagctcgagtgaagcagctccaagccagtaatgtcccggaggtgatggtcaacaaagtg
gagctggccccgctggggaatgacaagtaccaggacccgctgcagaaagtggtggctccc
agccctgcagaggaccagctcacgcccaggggaagggatgagagcccggcccagcccagg
agctgggttgaaaagttgaagaaggagatgtacatccggcagctgaaggtggagcggaag
ttatccattgctgcctccaagctggctctggagggccaggccaaggccaaaccaaagggc
aaggtgaaggctaaagctaaagccacgaagcaactgaagaacccaaaggctaaagtggct
gctgcctggagccagagccatgttggcccacgtggtgtctatgcccacagcaagcccagg
gtggcagcagcgaagaaggttgcaaaggtgcagaggtctcagagggtgcgggagggcaag
gacagcagccagtacaagatcctgcagcagaccatccagtccaaccttgagtgcttcctc
ttcttgcagcagccagaggaggctgagaggttccttctcttgtaccacagctcccctgtg
aagagaaggcttttgaatgtcaatgcatacaacatcgtgatgcgtagctgggcgagaaag
ggctgcttgcagcgcatcaaccggctgttttccatgctggagtccatcggcctgcagccc
agcctggactcctacgcggcagcactggagtgcatgggccgcaaccagtcatctgccaaa
gccatccaggggtgtttgcagaagctgaagaacgatggctttcacgtggatgagctcttc
cagaagtgcctgtttgaggaagatgagaaggagaaagtgctgagggccatcaggattgtc
cagcccaactaccagctgccccctccgcccaccccccagacctgcaagtcctctctgctc
caggatttctactccagagagaagatggtgtcataccccaagctggatttctctgtgcag
gagttgaaggagcgctttcagcagcagctggagatggaggtggacaacactataaccatc
gagtcagtagagtcagccaaacctctgaccccgcaagccattaaagcgcgcaaactgctg
gacacccttcgttcccagtggcatggctccattctccaggccctccagaagtcaaagcac
agcatgtccaagctcaagatggtgtcggggtacaacattctgtacccctacctgtgcctg
ctgccggatgaggagtatgtgggcatcatgctgcagatcctcaactccctctctccacaa
ggagaatccctggctgtcttggccagggacctgggctccaaagtctacaacagatacatc
acccagaggaagctgcgcagccgccagctggagaaggtgcaggaggtctatgagggctac
atccacctgctggcaaaggacagccagcctgacgagtacttgccacgggaatattgggag
aagctggtgatggaagcaggctttgggccttccctgaacttgaaggactgcagctggccg
tacatgctcctcatgcgcctgggcatgcacatgctggagctcctggtgaaggctgtcaag
gtgcccaggaacatcctcaaccctcgcctggagcccaagcttatccccgtcctctaccac
atctactccttccacagcagctggcaggttgggctgataaaaccccatcccatcttctcc
cagattgtgtcagatgctgcggagaccttgctgacctttaactcctctgccatacctatg
ctgtgccccccggtaccctggacctccccccacttcggtgcctttatcctgaatgacacc
aagctgatgcgttttgtggatggggtcatccagcaccagctgctcctggagcagtgtcct
ccggtgaacctccaccccgtgctggatgccctgaaccagctgggcaactgtgcctggaag
attaaccagccagtgctggatatcatcatttccatcttcaatgacaaaggcaatgagaag
ctggacatcccaccgcccatctctgaggcccccaggccttccgctgcttccagcaattcc
tctgcctggaacaagtcccagaagcacgagctgttgctgtgcaagaagaaggcggctgaa
atgcacagcttgcgcatggatgctctctataagctctccattgccaactacgtcagggac
aaggtgttctggtttcctcacaacatggacttccgaggcaggacttacccatgcccacct
tatttcaaccacctcggtaatgacgtcacccgggccatcctgctttttgcagagggaagg
ccactggggcccaagggcctcgactggttgaagatccacctcatcaacctcacggggctg
aagaagaagaacgccttgcaggagcggctggagtacgccaatgaaataatggaggagatc
ctggactcggctgaccacccgctgacgggcaggaagtggtggatgaacaccgacgaaccc
tggcaagccctggcgtgctgcatggaaatcgccaaagcctcgcggtccccggatccggca
gcctacatctctcacttcccggtccaccaggacggctcctgcaatggcctgcagcactac
gcagctcttggccgggaccttattggtgccacctctgtcaatctgatgccctgcagtgtt
ccccaggatgtctacagtgcggtggcccagcaggtggaggagtttcggaagaaggatgct
gaacggggggtgaagattgcccaggtgctgcaaggcttcatcagccgcaaggtggtgaag
cagacagtgatgacggtggtgtacggtgtcacacgctacggcgggcggctgcagatggag
aaacgtctcaaggagattgacgagttccctgaggaatacttgtgggaagcatctcactac
ctcgtgaagcaagtgttcaatggcatcaaggagatgttctcagcaactcgagatatccag
aactggctgacagagagcgccaagctcattgcccagtcaggacagacagtggagtgggtc
acgccgctgggtctccccatcgtgcagccctactatcggtccaggtccactgtgctgaat
tgcggcatgcagaacttgagtgtgaaaacctccaacagcaaccagaagcctgatacagtg
aagcagaagaacgccttcccacccaacttcatccactccctggactccacacacatgatg
ctcacggctctgcactgcctcaggcagggtctgaccttcgtctcagtccatgattgctac
tggactcacgcgctcaccgtggacgtcatgaaccagatctgtcggcagcaatttgtggct
ctgcacagcgagaagatcctgcaggatctgtccgagttcatgctggagaagtactgcagc
cctggcagagagaccagagccctctggcagaagaaactgatggagcagctgtcgaatgtc
cccaagacaggcgagttcaacctgaagaaggtgatggattccacctacttcttcagctga

DBGET integrated database retrieval system