KEGG   Egretta garzetta (little egret): 104124553Help
Entry
104124553         CDS       T05152                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 isoform X1
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00590  Arachidonic acid metabolism
egz01100  Metabolic pathways
egz04370  VEGF signaling pathway
egz04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    104124553 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    104124553 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    104124553 (PTGS2)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     104124553 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 104124553
NCBI-ProteinID: XP_009635205
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MTTGFDQYECDCTRTGYYGENCTTPEFFTWLRLTLKPSPNTVHYILTHFKGAWNIVNNVP
FLRDAIMRYVLTSRSHLIDSPPTYNSDYSYKSWEAYSNISYYTRSLPPVGLDCPTPMGVK
GKKELPDSKLIVEKFLLRKKFIPDPQGTNMMFTFFAQHFTHQFFKTDHKKGPGFTKAFGH
GVDLNHIYGETLERQLKLRLLRDGKLKYQMIDGEMYPPTVKDTAAEMIYPPHIPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLVLIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNLPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEIG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHILNPE
PTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaggatttgatcagtatgaatgtgactgtacaaggacaggctattatggggaa
aactgtacgacaccggaattcttcacgtggctgaggctaacattgaaaccttcaccaaat
actgtccactacatcctcacccacttcaaaggagcctggaatatcgtcaacaatgttccc
ttcttacgagatgctattatgagatacgtattaacgtcaagatcacacttgattgatagc
ccaccaacttacaatagtgattatagttacaaaagctgggaagcttattccaatatttcc
tattacacaagaagccttccaccagtaggacttgactgcccaacaccaatgggtgttaaa
ggtaagaaagagctcccagattcaaagctgattgtggagaagtttttgctaaggaaaaaa
ttcattcctgacccacaaggcacaaacatgatgttcacattctttgcccaacacttcacc
catcagttctttaagacagaccacaagaaaggacctggcttcactaaagcttttggccat
ggggttgacttgaaccatatttatggggagactctggagagacaacttaaactgagactt
ctaagggatggaaagctaaaataccagatgattgatggagaaatgtatccaccgacagta
aaggacactgccgcagagatgatctaccctcctcacatacctgaacacttgcagttttct
gtcgggcaggaggtgtttggtttggtcccaggtttgatgatgtatgctacaatatggctg
agggaacacaaccgcgtctgtgacatcctgaaacaggagcatccggagtgggatgatgag
cagctgttccaaactactagactcgtattgataggagagaccatcaagatcgttatcgag
gactatgtgcaacacttgagcggctaccacttcaaactcaagtttgatcctgagctgctg
ttcaaccagcgatttcagtaccagaaccgaattgcagctgaattcaatactctctaccac
tggcacccacttctgcctgacactttccagatacacgaccaggagtacactttccagcag
ttcctctacaacaactctataatgctggaacatggcctttcccatatggtgaaatctttc
tccaagcaaagtgctggcagggttgctggtgggaaaaaccttcctgctgcagtacagaaa
gtagcaaaggcttcaattgaccagagcagacaaatgcgataccagtccttgaatgagtac
aggaaacgcttcatgttgaaaccattcaaatcatttgaagaactcacaggagaaaaagaa
atggcagctgaactggaagaactttatggagacattgatgctatggagctgtacccaggc
cttctcgtagaaaagccacgaccaggtgccatcttcggtgaaacaatggtggagattgga
gcaccgttctctctgaaaggactgatgggaaatgctatctgctcccctgagtactggaag
cctagcacctttggtggaaaagtaggctttgaaataatcaatactgcctccttacagaag
ctcatctgcaacaatgtgaaaggctgtcctttcactgctttccacatcttgaatcctgaa
cccacagaggcaactattaatgttagtacctcaaaaacagcaatggaagatatcaacccc
acactgctactgaaagagcgatctgccgagttgtaa

DBGET integrated database retrieval system