KEGG   Egretta garzetta (little egret): 104124621Help
Entry
104124621         CDS       T05152                                 

Gene name
HK1
Definition
(RefSeq) hexokinase-1 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00010  Glycolysis / Gluconeogenesis
egz00051  Fructose and mannose metabolism
egz00052  Galactose metabolism
egz00500  Starch and sucrose metabolism
egz00520  Amino sugar and nucleotide sugar metabolism
egz00524  Neomycin, kanamycin and gentamicin biosynthesis
egz01100  Metabolic pathways
egz01200  Carbon metabolism
egz04910  Insulin signaling pathway
Module
egz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
egz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104124621 (HK1)
   00051 Fructose and mannose metabolism
    104124621 (HK1)
   00052 Galactose metabolism
    104124621 (HK1)
   00500 Starch and sucrose metabolism
    104124621 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    104124621 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    104124621 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104124621 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:egz04131]
    104124621 (HK1)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     104124621 (HK1)
Membrane trafficking [BR:egz04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    104124621 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 104124621
NCBI-ProteinID: XP_009635277
LinkDB All DBs
Position
Unknown
AA seq 889 aa AA seqDB search
MRLSDETLIDIMARFRREMKNGLSRDFNPTAAVKMLPTFVRSIPDGSEKGDFIALDLGGS
YFRILRVKVSHEKKQTVQMESEIYNTPEDIMHGSGTRLFDHVAECLGDFMEKQQIKDKKL
PVGFTFSFPCRQSKLDEGILITWTKRFKASGVEGADVVRLLNKAIKKRGDYDADIMAVVN
DTVGTMMTCGFDDQRCEVGLIIGTGTNACYMEEMRHIDLVEGDEGRMCINTEWGAFGDDG
SLEDIRTEFDREIDRGSLNPGKQLFEKMVSGLYMGELVRLILVKMAKEGLLFEGRITPEL
LTKGKFETKHVSAIEKSKEGLNKAKEILTRLGVEPSHEDCIAVQHVCTIVSFRSANLVAS
TLGAILNQLRDNKGVGRLRTTVGVDGSLYKMHPQYARRLHKTTRRLVPDSEVRFLLSESG
SGKGAAMVTAVAYRLSEQHRLIDETLAEFKLTHEQLLQVKKRMRAEMEAGLKKKTHETAK
VKMLPTFVRSTPDGTENGDFLALDLGGTNFRVLLVKIRSGKRRTVEMHNKIYAIPIEVMQ
GTGEELFDHIVTCISDFLDYMGIKGARLPLGFTFSFPCKQTSLDAGILLNWTKGFKATDC
EGEDVVYLLREGIKRREEFDLDVVAVVNDTVGTMMTCAYEDPNCEIGLIVGTGSNACYME
EMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDDIRTIYDKAVDDYSLNAGKQRYEKMISGM
YLGEIVRNILIDFTKRGFLFRGQISETLKTRHIFETKFLSQIESDRLALLQVRAILQQLG
LNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAAVVDKIRENRGLEHLEITVGVDGTLYKLH
PHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKGAALITAVGCRLRDAEQN
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcggctctctgacgaaacgctgatagacattatggctcgcttcaggagagagatgaag
aacggcctctccagggactttaacccaacggctgcagtcaagatgcttcctacatttgtg
aggtccattcctgatggttcagagaaaggagatttcattgccctggatctcggcggttct
tatttccgaattctgcgggtgaaggtatcgcatgaaaaaaagcagacggtacaaatggaa
agtgagatttataacacgcccgaagatatcatgcacggcagcggaacacggctttttgat
catgttgctgaatgcctgggagacttcatggagaaacaacaaatcaaagacaagaaatta
ccagtcgggtttacgttttctttcccatgtcgacagtccaagctagatgagggcattctg
ataacctggacgaagcgcttcaaagcaagtggagtggagggagcagatgttgtgaggctg
cttaacaaggccatcaagaaacgtggggactacgatgcggatatcatggctgttgtgaat
gacaccgttgggactatgatgacctgtggttttgatgaccagcgctgcgaagttggcttg
atcattggcactggcaccaacgcctgttacatggaggagatgcggcacatcgacctggtg
gaaggggacgagggcaggatgtgcattaacacagagtggggggcctttggagatgatggc
tcgctagaagacatcaggaccgagtttgatcgagagatcgaccgtggatcccttaatcct
gggaagcagctgtttgagaagatggtcagcgggctgtacatgggggagctggtaaggctc
atcctggtgaagatggccaaggaggggctgctctttgaggggagaatcacccctgagctt
ctcaccaaagggaagtttgagacgaagcatgtttctgccatagaaaagagcaaagaaggt
ttgaacaaagccaaagaaattttaacccgcctgggggtggagccatcccacgaggactgc
atcgccgtccagcacgtctgcaccatcgtgtccttccgctcggccaacctggtagcctcc
acgctgggtgccatcctcaaccagctgcgggataacaagggggtcggccgcctccggacc
accgtgggggtcgatggctccctctacaagatgcatccccagtacgcccggcgcttgcac
aaaaccacccggcgcttggtgcctgactcggaagtgcggttcctgctgtcggagagcggc
agcgggaagggagcagcgatggtgacggcggtggcgtaccggctgtcggaacagcaccgg
ctcatcgacgagacgctggccgagttcaagcttacccacgagcagctgctgcaggtgaag
aagaggatgagggcagagatggaagcagggctgaagaagaagactcacgagactgccaaa
gtgaaaatgctgcccaccttcgtccgtagcacaccagatgggacagagaatggagacttt
ctggcacttgaccttggagggacaaactttagagttttgctggtgaaaatccgcagcggt
aagaggagaacagttgagatgcacaacaagatctatgccattcctatagaggtgatgcag
ggaacaggagaagagctgtttgatcacatcgttacctgcatttctgacttcctggattat
atgggaataaaaggcgcacgtcttcctcttggcttcacgttttccttcccttgcaagcag
accagtctggacgctggtatccttctcaattggacaaaaggcttcaaagctacagactgc
gagggagaagatgtggtatatttgcttagagaaggaattaaaagaagagaggagtttgac
ttggatgtggtggctgtggtgaatgacacagtgggcacaatgatgacttgcgcctatgaa
gacccaaactgtgaaatcgggctcattgtgggaactggcagcaatgcctgttacatggaa
gagatgagaaacatagagatggtggatggtgagcaaggacggatgtgcgtgaacacggag
tggggagcgttcggggataatggatgcctggacgatatcaggacaatatatgacaaagca
gttgatgactattcactaaatgctggaaagcaaaggtacgagaagatgatcagtgggatg
tacctgggggaaatagtccgcaatattttgatcgacttcaccaaacgggggttcctgttc
agaggccagatttcggagacgctgaagaccaggcatatctttgaaaccaagttcctttct
cagattgagagtgacaggttagccttgctgcaggtgcgagccatcctccagcagctgggg
ctcaacagcacctgcgacgacagcatcattgtcaagaccgtgtgcggagccgtgtcgagg
cgggcagctcagttgtgcggcgccggcatggctgcggtcgtagataaaattagggagaac
agaggattagagcacctggagataacagttggtgtggatgggactctgtacaaactacat
ccacacttttcgaggatcatgcaccaaacagtcaaggacctggcacccaactgcgacgtg
accttcctgctgtcagaggacggcagcgggaaaggggcagcgctcatcacagcggtggga
tgcaggcttcgcgatgccgagcagaactga

DBGET integrated database retrieval system