KEGG   Egretta garzetta (little egret): 104124647
Entry
104124647         CDS       T05152                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X1
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
egz04115  p53 signaling pathway
egz04218  Cellular senescence
egz04540  Gap junction
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124647 (CDK1)
   04114 Oocyte meiosis
    104124647 (CDK1)
   04115 p53 signaling pathway
    104124647 (CDK1)
   04218 Cellular senescence
    104124647 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104124647 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104124647 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104124647 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104124647 (CDK1)
   03036 Chromosome and associated proteins [BR:egz03036]
    104124647 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104124647 (CDK1)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104124647 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     104124647 (CDK1)
Protein kinases [BR:egz01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104124647 (CDK1)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104124647 (CDK1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    104124647 (CDK1)
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   104124647 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH RIO1 Kdo Kinase-like Seadorna_VP7
Other DBs
NCBI-GeneID: 104124647
NCBI-ProteinID: XP_009635306
LinkDB
Position
Unknown
AA seq 302 aa
MDDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELHH
PNIVCLQDVLMQDSRLYLVFEFLSMDLKKYLDTIPSGQYLDRSRVKSYLYQILQGIVFCH
SRRVLHRDLKPQNLLIDDKGVIKLADFGLARAFGIPVRVYTHEVVTLWYRSPEVLLGSAR
YSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNT
FPKWKPGSLGTHVKNLDEDGLDLLSKMLIYDPAKRISGKMALNHPYFDDLDKSTLPANLI
KK
NT seq 909 nt   +upstreamnt  +downstreamnt
atggatgattacacaaaaatagagaagattggggaaggtacctatggtgttgtgtataaa
ggtcggcacaaaaccacaggccaagtggttgcaatgaagaaaatacgtctagaaagtgag
gaggaaggtgttccgagcactgctatccgagaaatttctttattaaaagagctacatcat
cccaatatagtctgtcttcaggatgttcttatgcaggattcaagactgtacctcgtcttt
gaattcctttccatggatctcaagaaatacttggatactattccatctggccaatatttg
gatcgttcacgtgttaagagttacttgtatcaaatcttgcaaggtattgtcttctgccat
tcaagaagagttctgcacagagacttaaaacctcagaatctcttaatagatgacaaggga
gtgattaaactggcggacttcggattggctcgagcctttggaattcccgtgcgggtatac
actcatgaagtagtgacactgtggtacaggtctccagaggtgttgctaggatctgctcgt
tactctactcctgtagatatatggagcataggtaccatatttgctgagctagcaactaaa
aagccgcttttccacggggactcggagattgaccagctcttcaggatcttcagagcttta
ggtacccccaacaatgaggtatggcctgaagtggaatccctgcaagactacaaaaacaca
ttcccaaaatggaaacctggcagcctgggaacacatgtcaaaaacctggatgaagatgga
ctcgatctgctgtctaaaatgttaatttatgatcctgcaaaaagaatttctggcaaaatg
gctttgaaccatccatattttgatgacttggataaatctactcttcctgctaatctgatt
aagaaataa

DBGET integrated database retrieval system