KEGG   Egretta garzetta (little egret): 104124693
Entry
104124693         CDS       T05152                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04218  Cellular senescence
egz04310  Wnt signaling pathway
egz04340  Hedgehog signaling pathway
egz04371  Apelin signaling pathway
egz04510  Focal adhesion
egz04530  Tight junction
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104124693 (CCND1)
   04340 Hedgehog signaling pathway
    104124693 (CCND1)
   04371 Apelin signaling pathway
    104124693 (CCND1)
   04068 FoxO signaling pathway
    104124693 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124693 (CCND1)
   04115 p53 signaling pathway
    104124693 (CCND1)
   04218 Cellular senescence
    104124693 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104124693 (CCND1)
   04530 Tight junction
    104124693 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104124693
NCBI-ProteinID: XP_009635356
UniProt: A0A091J1P1
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAHLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccggcgagcccacctggatgcc
aacctcctcaatgacagggtgctgcagacaatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaggaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgtttgaacccctcaagaaaagccgattgcaa
ttgctgggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgagttactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
cacgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system