KEGG   Egretta garzetta (little egret): 104124904
Entry
104124904         CDS       T05152                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
egz04115  p53 signaling pathway
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104124904 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104124904 (CCNB1)
   04114 Oocyte meiosis
    104124904 (CCNB1)
   04115 p53 signaling pathway
    104124904 (CCNB1)
   04218 Cellular senescence
    104124904 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104124904 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104124904 (CCNB1)
   03036 Chromosome and associated proteins [BR:egz03036]
    104124904 (CCNB1)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104124904 (CCNB1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104124904 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104124904
NCBI-ProteinID: XP_009635576
LinkDB
Position
Unknown
AA seq 315 aa
MESQSPVPMDISGCTASEDVLCQAFSDVLLDVEDVDAEDGADPKLCSDYVKDIYKYLRSL
EENQPVRPKYLAGQEINGNMRAILIDWLVQVQVKFGLQQETLYMAVAIIDRFLQDNAVTK
EVLQLVGVTAMFVASKYEEIYPPHIGDFAYVTDNTYTKFQICQMEMKILRALDFDLGRPL
PPHFLRRASKIAEVDLEQHILAKYLMELSIVDYDMVHFPPSKTASAASCLALKLLDGCEW
TPTLQHYMSYTENDLLPVMQHIAKNVILVNEGITKYVAIKNKYASSKNCKISRLEQLDST
IVWNLAQPLIKQLRK
NT seq 948 nt   +upstreamnt  +downstreamnt
atggaatctcagtctccagtccccatggacatatctggatgcaccgcatcggaggatgtg
ctgtgtcaggctttttctgatgtcctgcttgatgtggaagatgtagatgcggaagatggt
gctgacccaaaactctgcagtgactatgtgaaggacatctacaagtacctgagaagcctt
gaggaaaatcaacctgtcagacctaaatacctagccggccaggaaattaatgggaatatg
cgtgccatactgatagactggcttgtgcaagtacaggtaaaattcggactccagcaggag
accttgtacatggcagttgctatcatcgatcgctttctgcaggacaatgctgttactaag
gaggtgttgcagctggttggtgtcacagcaatgtttgttgccagcaaatatgaagaaatt
tatcccccacatattggagattttgcctatgtgacagacaacacttacacaaagtttcag
atctgccagatggagatgaagatcctgcgagccctggactttgatctgggtcgcccgctc
cctccgcacttcctaaggagggcttcaaagattgcagaggtggacttggaacagcacatt
ctggccaagtaccttatggaattgtccattgtggactatgatatggttcacttcccccca
tccaagacagcttcagctgcttcctgtttggctctgaaactccttgatgggtgtgagtgg
acaccaactctgcaacactacatgtcttacactgagaatgaccttctcccagttatgcag
cacatagcaaagaacgtcattcttgtgaatgagggcattaccaagtatgtggcaatcaag
aacaaatacgccagcagcaaaaactgtaagataagtcgccttgaacagctggactctact
atcgtatggaacctagctcaacctctgattaaacaactgcgaaagtag

KEGG   Egretta garzetta (little egret): 104130767
Entry
104130767         CDS       T05152                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
egz04115  p53 signaling pathway
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104130767 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104130767 (CCNB2)
   04114 Oocyte meiosis
    104130767 (CCNB2)
   04115 p53 signaling pathway
    104130767 (CCNB2)
   04218 Cellular senescence
    104130767 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104130767 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104130767 (CCNB2)
   03036 Chromosome and associated proteins [BR:egz03036]
    104130767 (CCNB2)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104130767 (CCNB2)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104130767 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104130767
NCBI-ProteinID: XP_009642131
LinkDB
Position
Unknown
AA seq 408 aa
MVLPEAYTEETSSSEHVTRGVENAAIELKSKVKTRLADNKRGALEEIGNTVATRGTRIAK
KTECSKASIKPTKGLSKMTNVTVVPKPPAAVKQSSKETAVPKVLSPVPMDVSMQEEDLCQ
AFSDVLLNNVEDIDAEDWENPQLCSDYVKDIYLYLRELELQQSVRPHYLDGKTINGRMRA
ILVDWLVQVHSRCQLLQETLYMCVAVMDRFLQSHPVSRKRLQLVGITALFLASKYEEVFS
PDVACMVYVTDNAYTTDEVREMEITILKELNFNLGRPLPIHFLRRASKAGEADAKQHTLA
KYLMELTLIDYDMVHYHPSEIAAAALCLSQKVLGHNTWGTKHQYYTGYTEENLVMAMKHM
AKNVVRVNERLTKYTAVKNKYASTKLLMISTIPQLSGKVIKDLALSLL
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggtactgcctgaagcctatacagaggagacttcttcctctgagcacgtcactagaggg
gtagagaatgctgcaattgaacttaaaagtaaagtcaaaactcgccttgctgacaacaaa
aggggtgctttggaagaaataggaaatacagttgcaacgcgaggaacacgtatagctaag
aaaacagaatgctccaaagcatccataaagcctacaaaaggacttagtaagatgacaaat
gtaactgtagtgcctaaacctccagctgctgtgaaacaatcatccaaagaaactgctgtt
ccaaaggttctgtctcctgtccctatggatgtgtctatgcaagaggaggatttgtgccag
gctttctctgacgtgttgctcaacaatgtagaagacattgatgctgaggactgggagaat
ccccagctatgtagcgactacgtaaaagatatctacctgtatctgagagagcttgagctg
cagcaatcggtccgcccgcattaccttgacgggaagacgatcaatgggcgtatgcgtgca
attttagttgactggcttgtccaggtccactcaagatgccagcttttgcaggaaacactg
tatatgtgtgttgcagttatggatcgcttcttacaaagtcatccagtatctcgtaagagg
cttcagctagtgggcataacagcattgtttctagcttcaaaatacgaagaggtgttctct
cctgatgtagcatgcatggtttatgttactgacaatgcctacaccactgatgaagttaga
gaaatggagattacgattcttaaagagttaaacttcaatttgggacgacctcttccaatt
cacttcttaagaagagcatcaaaagctggggaggctgatgctaagcaacatacactagca
aaatacctaatggagctgacgctgatagactatgacatggttcactatcatccttcggag
attgcagctgctgcgttatgcttgtcccaaaaggttctgggacataacacatggggtaca
aagcaccagtactacactgggtatacagaagagaatcttgtgatggctatgaaacatatg
gccaagaatgtggtcagagtaaatgagaggttaacaaaatacactgctgtaaagaacaag
tatgcaagtaccaaactactgatgatcagcacaatccctcaactgagcggcaaagtaatc
aaggacctggctctatcactcttatga

KEGG   Egretta garzetta (little egret): 104133018
Entry
104133018         CDS       T05152                                 

Gene name
CCNB3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104133018 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104133018 (CCNB3)
   04218 Cellular senescence
    104133018 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104133018 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104133018 (CCNB3)
   03036 Chromosome and associated proteins [BR:egz03036]
    104133018 (CCNB3)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    104133018 (CCNB3)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104133018 (CCNB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104133018
NCBI-ProteinID: XP_009644680
LinkDB
Position
Unknown
AA seq 402 aa
MPLPRNAKMLSTKQPRAGKAGPAAENAKPEKEENCQAKRSPSSPQGGPKKRSAFGDITNA
HKNQVMAGKKEAVKVAPHKAQRALGVAKNNEINLKKSMKKTPPTEAPAEAKEDPVPEALV
PAQVPEVEDIDKEQLGDPYANAEYAKEIFEYMRGREEKFVLPNYMEKQTDISRDMRAILV
DWMVEVQENFELNHETLYLAVKLVDHYLVEVVSMRDKLQLIGSTAILIASKFEERCPPCV
DDFLYICDDAYKREELIAMEMSILSTLKFDINIPIPYRFLRRFAKCARATMETLTLARFL
CEMTLQEYDYARESPSKLAASCLLLALIMKNLGGWTPTLEYYSGYRSQDLHPLVKRLNFL
LTYQPHDKLKAVRTKYSHRVFFEVAKVTPMDMLKLEETLKSC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgccgttgccacgcaacgccaagatgctgagcaccaagcagccccgagcaggcaaggcg
ggccctgccgcagagaatgccaagcctgagaaggaagagaactgtcaagccaagaggtct
ccatcctcaccccagggcgggcccaagaagaggtcagcatttggggacatcaccaatgct
cacaagaaccaggtgatggcagggaagaaggaggctgtgaaagtggcaccacacaaggca
cagagggccctgggggttgccaagaacaatgagatcaacctgaaaaagtcaatgaagaaa
actccccctacagaggctcctgcagaggccaaggaggatcctgtgccagaggcgctggtg
cctgcgcaggtaccagaagtggaggacatagacaaggagcagctgggagacccctatgcc
aatgcagagtacgccaaggagatctttgaatacatgcggggaagagaggagaaatttgtc
ctccccaactacatggagaagcagacagacatcagcagggacatgcgtgccatcctggtg
gactggatggtggaggtgcaggagaactttgagctgaaccatgagactctgtacctggcc
gtgaagctggtggaccactacctggtggaggtggtgagcatgagggacaagctgcagctc
attggctccaccgccatcctcattgcctccaaatttgaggagcggtgcccaccgtgcgtg
gatgacttcctctacatctgtgacgatgcctacaagcgggaagagctcattgctatggag
atgagcatcctcagcaccctcaagttcgacatcaacatccccatcccctaccggttcctg
cgacgctttgccaagtgtgcccgtgccaccatggagacactgacgctggcccgcttcctc
tgtgagatgaccctgcaggagtacgactatgcccgggagagcccctccaagctggccgcc
agctgcctgctgctggcactcatcatgaagaacctcggtggctggacccccacactggag
tactacagcgggtaccgctcccaggacctgcaccccctggtgaagaggctgaatttcctg
ctcacgtaccagccccacgacaagctgaaggccgtccgcaccaagtactcacacagggtc
ttctttgaggttgccaaagtcacccccatggacatgctcaagctggaagagacactgaag
agctgctag

DBGET integrated database retrieval system