KEGG   Egretta garzetta (little egret): 104125023Help
Entry
104125023         CDS       T05152                                 

Gene name
DCC
Definition
(RefSeq) netrin receptor DCC
  KO
K06765  deleted in colorectal carcinoma
Organism
egz  Egretta garzetta (little egret)
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N V-set Interfer-bind Ig_6 C2-set_2 Ig_4 Protocadherin EphA2_TM CD34_antigen FAM176 TMEM154 Arylsulfotran_N PRIMA1
Motif
Other DBs
NCBI-GeneID: 104125023
NCBI-ProteinID: XP_009635714
LinkDB All DBs
Position
Unknown
AA seq 1483 aa AA seqDB search
MRLKADSQIQKLQWIRFARYERFAVVLQTAVTLTASVGGTSDVVPCKPRSDLMISLATGG
KPVLLAGCKPRALARAADGKMKRFTPSDLCINRGQAVYCATVNGRVLLSVSRRLVNKYER
FRCFEYLLRFFPLLIEKSGNWEMLLPTEPYVHVICTLCKAAMLPDNEVHDLDIVFRLHFV
SCRPRPVFADFFFRPLRFLSQTESVTAFAGDTILLKCEVVGEPMPVVHWQRNQEDLFPSP
ADARVAVLPSGALQISRVQHGDSGIYRCLAKNPASSRTGNDAEVRVLADPGLHRQQFFLQ
RPSNVVAMEGKDAVLECCVSGYPPPTFTWLRGDEVLPVRSKKYSLLAGSNLLISNVTDDD
SGMYTCVVTYKNENSSGSAELSVMVPPWFLIRPSNLYAYESMDIEFECAVSGKPVPTVEW
IKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGFYQCVAENEAGNAQASAQLIIPEPAVPS
SSVLPSAPRDVVPVLVSSRFVRLSWRPPAEARGSVQTYTVFFSRDGVNRERAVNTSQPGT
LQLTVGNLKPEETYTFRVVAYNEWGPGESSQPVKVATQPELQVPGPVENLRAVSTSPTSI
LVSWDPPAYANGPVQGYRLFCTETATGREQNVEVDGLSYRLEGLKKFTEYTLRFLAYNRY
GPGVSTEDVTVTTLSDVPSAMPQNVSLEVVNSRSIKVSWLPPPPGTQNGFITGYKIRHRK
TTRRGEIETLEPNNLWYLFTGLEKGSQYSFQVAAMTVNGTGPPSDWYTAETPENDLDESQ
VPDQPSSLHVRPLTTSIVMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRYYSIE
NLEPSSHYVISLKAFNNAGEGVPLYESATTRSMTVPDISTPMLPPVGVQAVTLTHDAVRV
IWADNSVPKNQKTTEVRFYTVRWRTSYSTSAKYKSADTTALSHTVIGLKPNTMYEFSVMV
TKGRRSSTWSMTAHATTYEAAPTSAPKDLTVITREGKPRAVIVSWQPPLDANGKITAYIL
FYTLDKNAPIDDWIMESISGDRLTHQIMDLNLDTVYYFRIQARNAKGVGPLSDPIFFRTL
KVEHPDKMANDQGRHGDGSYWPVDTNLIDRSSLNEPPIGQMHPPHGSVTPQKNSNLLVII
VVTIGVITVVVVVVVAIICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHEEMEM
KNIEKPTGSDPAGRDSPMQSCQDITPVSHSQSETQLGSKSTPQPGPETEDVGSSMSTLER
SLAARRATRAKLMIPMDSQPTNPPVVSAIPVPTLESAQYPGILPSPTCGYPHPQFTLRPV
PFPTLSVDRTFGAGRTVSEGPAPQQPSLLPQTQPEHSNSEDAPSRTIPTACVRPTHPLRS
FANPLLPPPMSAIEPKVPYTPLLSQTGPNLPKAQVKTASLGLAGKARSPLLPVSVPTAPE
VAEEGHKQTEDSANVYEQDDLSEQMASLEGLMKQLNAITGSAF
NT seq 4452 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcaaagccgacagccagattcagaagctgcaatggataaggtttgcacggtac
gagaggtttgcggtggtcttacagaccgcagtgaccctgaccgcatctgtcggaggaact
agcgatgtcgtgccgtgcaagcctcgctcggatttgatgatttcattggcgactggcggg
aagcctgtgctgctggctggctgcaagccacgagcgctggcaagagcggccgacgggaag
atgaagagatttacaccctctgatttgtgtattaacaggggccaagcggtgtattgtgcc
actgtgaatggcagggtgttactgagcgtatcacgtaggctcgttaataaatacgagcgg
tttcgttgctttgaatatctcctgcgctttttcccccttctcattgagaaatcgggcaat
tgggaaatgctgctgcccacggaaccgtacgttcacgttatctgtactctttgtaaagca
gcgatgcttccagataatgaagtccacgatcttgacatcgtctttcgcttgcactttgtg
tcttgcagaccccgtcctgttttcgctgactttttcttccgaccactgaggtttctttcc
cagacagaatctgtcacggctttcgcaggagacaccattctgctgaagtgtgaagttgtt
ggggagcccatgcctgtggtgcactggcagcgaaaccaggaggacttgttcccgagcccg
gccgacgcacgggtcgccgtcctaccttccggagctttacagatcagcagggttcagcac
ggggacagcgggatctacagatgcctggcgaaaaacccagctagttcgagaactggaaac
gatgcagaagtcagagttctggcagatccaggtttgcacaggcagcagtttttcctgcag
cgcccgtcgaacgtggtggccatggaagggaaggatgccgttctggagtgctgcgtttct
gggtacccccctcccaccttcacgtggctgcgaggagatgaagtgctccccgtcaggtcc
aaaaagtattcgttactggctggcagtaacctgctcatatcgaacgtgactgacgacgat
tctgggatgtacacgtgcgtcgtcacctacaaaaacgagaacagcagcggctctgcggag
ctgtcagtgatggttccaccatggtttttaattcgcccttcaaatctttatgcctatgag
agtatggatattgagtttgaatgtgccgtgtctggtaagcctgttcctacggtggagtgg
atcaagaatggagaagtggtcattcccagcgactattttcagatagtgggtggcagcaac
ttacggattctgggcttggtaaagtcagatgaaggtttttatcagtgtgtagctgaaaat
gaagctggaaacgcacaggccagtgcacagctaatcatcccagagcctgctgtcccaagt
tccagtgtcctcccctctgccccccgagatgtggtccctgttttggtctccagccgattt
gtccgtctcagctggcgcccacccgcagaagccagaggcagcgtccagacgtacacggtc
ttcttctccagggatggcgtcaacagggaacgggcagtcaacacatctcagcctgggaca
cttcaacttaccgtgggcaacctgaagccagaggagacctacaccttccgcgtggtggcc
tacaacgagtggggaccaggagaaagctcgcagcccgtcaaggtcgccacgcagccggag
ctgcaagttcctgggccggtggaaaacctgcgggccgtgtctacctcacctacctcaatt
cttgtctcctgggatccccctgcctatgcaaatggccccgttcaaggctaccggctcttt
tgtacggagacagcgactggaagagagcagaacgtggaggtggacgggctctcctaccgg
ctggaggggctgaagaagttcaccgagtacaccctgcgcttcctcgcctacaaccgctat
ggccccggcgtctccaccgaggatgtgacagtcaccacgctttcggatgtgcccagcgcg
atgcctcagaacgtctccttggaagtggttaactccaggagcatcaaagttagctggttg
cctccaccaccaggtactcaaaatggatttattacgggctataaaatccgacatagaaag
actacccgcaggggtgagattgaaacactggagccgaacaacctctggtacttgttcaca
ggactcgagaaaggaagccagtacagtttccaggtggctgccatgacagtgaatgggaca
gggcccccctcggactggtacacagcagaaacacccgagaacgatctcgacgaatctcag
gttcccgaccagccaagctctcttcatgtcaggcccttgacaacaagcatcgtcatgagt
tggactccaccgctgaacccgaacattgtcgtccgcgggtacatcatcggctacggcgtc
ggcagtccgtatgctgagactgtgcgggtggacagtaaacagcgttactattccatcgaa
aatctggagccgagctcccattacgtgatttccttaaaggcgtttaacaacgcaggcgaa
ggggtgcctctgtacgaaagcgcgaccacccggtcgatgacagtcccagatatctccacc
cccatgctcccaccagtaggtgtccaggctgttacacttacgcatgatgcagtgagggtc
atctgggcagacaactctgtcccaaagaaccaaaagactacggaggttcgcttctacacg
gtccgatggagaacaagctattcgacaagtgctaagtacaagtcggccgatacgaccgcg
ctgagtcacaccgtgataggtctgaagccaaacaccatgtacgagttctccgtcatggtc
accaaaggtcggcggtccagcacctggagcatgaccgcgcacgccaccacctatgaagca
gctccaacctctgctcccaaggatttgacagtcattacacgggaagggaagccccgggct
gtcattgtcagctggcagccgccgttggatgccaatggaaaaattactgcttacatcctc
ttctatactttggacaagaatgctccgattgacgactggattatggagtccatcagcgga
gaccggctcacccaccagatcatggacctcaacctggacaccgtctactacttcagaatc
caagctcgcaacgccaagggagtggggcccctctccgatcctattttcttccggacgctg
aaagtcgagcaccctgacaagatggcgaacgaccaaggtcgtcacggggatggttcctac
tggccggtggacaccaacctgattgacaggagcagtctgaacgagcctcccatcgggcag
atgcaccctccccacggcagcgtcacgccccagaagaacagcaacctcctcgtcatcatc
gtcgtcaccatcggcgtcatcaccgtggtggtggtggtggtggtggccatcatctgcacc
aggcgctcctcggcacagcagaggaagaaacgtgcaacccacagtgctggtaaaaggaag
ggcagccagaaggacctgagacccccagatctgtggatacaccatgaggagatggaaatg
aagaacatcgagaagccgacgggctcggaccccgcaggaagggattccccaatgcagagc
tgccaggacatcacccccgtcagccacagccagtcggaaacgcagctgggcagcaagagc
accccgcagcccggtcctgagacagaagatgtcggaagcagcatgtccacgttagagcgc
tcactggctgcccgcagagccacccgtgccaagctcatgatccccatggattcacaacca
accaaccctcctgtggtcagtgccattccggtgccaacactagaaagtgcccagtacccc
gggatcctgccgtccccgacctgcggatacccccacccgcagttcacccttcggccggtg
ccgttcccgaccctctctgtggacaggacctttggagcaggaagaactgtgagcgaagga
ccagcaccacagcagccatccttgctaccgcagacgcagcctgagcactccaacagcgag
gacgccccgagcagaaccatccccaccgcctgtgtccgtccgacgcaccctctccgcagc
tttgccaaccccttgctacctccgcccatgagtgcaatagaaccgaaagtcccttacacg
ccacttctgtctcaaacagggcctaacctccccaaggctcaggttaaaacagcatccctt
ggcttggcaggaaaagccaggtcgcctctgctgcccgtctcggtgcccacggccccggag
gtggcagaagagggccacaagcagacggaggactccgcaaacgtttatgagcaggatgat
ctgagcgaacagatggccagtttggaggggctaatgaagcaactcaatgctatcacgggc
tcagccttctaa

DBGET integrated database retrieval system