KEGG   Egretta garzetta (little egret): 104125131Help
Entry
104125131         CDS       T05152                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00562  Inositol phosphate metabolism
egz01100  Metabolic pathways
egz04068  FoxO signaling pathway
egz04070  Phosphatidylinositol signaling system
egz04115  p53 signaling pathway
egz04140  Autophagy - animal
egz04150  mTOR signaling pathway
egz04218  Cellular senescence
egz04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    104125131 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    104125131 (PTEN)
   04070 Phosphatidylinositol signaling system
    104125131 (PTEN)
   04150 mTOR signaling pathway
    104125131 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104125131 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    104125131 (PTEN)
   04218 Cellular senescence
    104125131 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104125131 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egz01009]
    104125131 (PTEN)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     104125131 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     104125131 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     104125131 (PTEN)
Protein phosphatases and associated proteins [BR:egz01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    104125131 (PTEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 104125131
NCBI-ProteinID: XP_009635832
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHN
PPQLELIKPFCEDLDQWLSEDDNHVAAIHCKAGKGRTGVMICAYLLHRGKFLKAQDALDF
YGEVRTRDKKGVTIPSQRRYVYYYSYLLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQ
FVVYQLKVKIFTSPSGPSRREDKYMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFW
VNTFFIGLDENSDKVENGSLVADQELDGIFSTERSDNDKEYLILTLTKNDLDKANKDKAN
RYFSPNFKVKLFFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDE
DQHTQITKV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgggttttcctgcggagaggcttgaaggagtgtaccggaacaacattgatgatgtagta
aggtttctggattcaaagcataaaaaccattacaagatatacaatctatgtgctgaaaga
cattacgacaccgccaaatttaactgcagagttgcacagtacccttttgaagaccataac
ccaccacagctagagcttatcaaacctttttgtgaagatcttgaccaatggctaagtgaa
gatgacaatcatgttgcagcaatccactgtaaagctggaaagggacgaactggtgtaatg
atatgtgcatatttgttgcatcgaggcaagtttttaaaggctcaagatgccctagatttc
tatggggaagtaaggaccagagacaagaagggagtgacaattcccagtcagagacgttac
gtgtactactatagctacctgttaaagaatcacctggattacagacccgtggcactgctg
tttcacaaaatgatgtttgaaacaattcccatgttcagcggcggaacttgcaatcctcag
tttgtggtgtaccagctaaaggtaaagatattcacctccccttcaggaccctcaagacgt
gaagacaagtatatgtactttgaattccctcaacctttgccggtatgcggtgatatcaaa
gtggaattcttccacaaacagaacaagatgttgaaaaaggacaaaatgtttcacttttgg
gtaaatacattcttcataggactggatgaaaattcagacaaagtagaaaatggaagtcta
gttgcagatcaggaacttgatggtattttcagtacagagcgctcggataatgataaggaa
tatttaatccttacattaacaaaaaacgatctagacaaagcaaataaagacaaagccaac
agatatttctctccaaacttcaaggtgaagctatttttcacaaaaacggtagaagagcca
tcaaatccagaggctagcagttcaacttctgtaacgccagacgttagtgacaatgaacct
gatcattatagatactcggacaccactgactctgatccagagaatgaaccttttgatgaa
gatcagcatacgcagattacaaaagtctga

DBGET integrated database retrieval system