KEGG   Egretta garzetta (little egret): 104125236
Entry
104125236         CDS       T05152                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04144  Endocytosis
egz04218  Cellular senescence
egz04310  Wnt signaling pathway
egz04350  TGF-beta signaling pathway
egz04371  Apelin signaling pathway
egz04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    104125236 (SMAD3)
   04350 TGF-beta signaling pathway
    104125236 (SMAD3)
   04371 Apelin signaling pathway
    104125236 (SMAD3)
   04068 FoxO signaling pathway
    104125236 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104125236 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    104125236 (SMAD3)
   04218 Cellular senescence
    104125236 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    104125236 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 ATP-synt_D
Other DBs
NCBI-GeneID: 104125236
NCBI-ProteinID: XP_009635956
LinkDB
Position
Unknown
AA seq 457 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTLNC
DECLTLNLDCRNILGVSTPSVVRRRDTSGLLSNPEQVRLESLDGRLQVSHRKGLPHVIYC
RLWRWPDLHSHHELRAMEMCEYAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAE
FPPLDDYSHSIPENTNFPAGIEPQSNYIPETPPPGYLSEDGETSDHQMNPSMDAGSPNLS
PNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSER
FCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHP
ATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQT
VTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtcctccatcctgcctttcactcctcccatcgtcaagcggctcctgggctggaagaaa
ggggagcagaacgggcaggaggagaaatggtgcgagaaggcggtgaagagcctggtgaag
aagctgaagaagacggggcagctggacgagctggagaaggcgatcaccacgctgaactgt
gatgagtgtttaactctgaaccttgattgtaggaacatcttgggtgtgagcacgccttct
gttgtaaggaggagagatacttctggtctactttcaaacccagaacaagtaagacttgaa
tcattagatggccggttgcaagtatctcaccggaaaggtcttccccatgtgatctactgc
cggctgtggcgatggccggacctccatagccaccatgagttgcgtgccatggagatgtgc
gagtacgcctttaacatgaagaaggatgaagtctgcgtgaatccttatcattaccaaaga
gtggaaaccccagtgttacctccagtgctggtgcctcggcacacagagatcccagctgag
ttcccgccgttagatgattatagtcattctattccagagaacactaacttcccagcaggt
atcgagccacagagcaactacattccagagacacctcctccaggctacttgagtgaggat
ggagaaactagtgaccaccagatgaaccccagcatggatgcaggttctccaaacttatca
ccaaaccctatgtctccagcacacaataatctggatctgcagcctgttacctactgcgag
ccagctttctggtgctcgatatcctactacgaactcaaccagcgagtgggagagactttc
cacgcctcccagccctctatgaccgtggatggtttcaccgacccatctaattctgaacgc
ttctgccttggtttactgtccaacgtgaacagaaacgcagcagtggaactcacaagacga
cacattggaagaggagtgaggctctactacattggcggcgaggtgtttgccgagtgcctt
agtgacagtgccatttttgtccagtctcccaactgcaaccaacgctacggctggcaccca
gcaacagtttgcaagattccaccaggatgtaacttgaagatctttaacaaccaggaattc
gccgctctcttggctcagtctgtaaaccagggcttcgaagctgtgtaccagctgaccaga
atgtgcaccattcgaatgagctttgtcaagggatggggagcagaatacaggcggcagact
gtgaccagtactccctgctggattgaactgcatcttaatggtcctttgcagtggctggac
aaggtcctgacacaaatgggctccccaagcattcgttgttccagcgtctcctaa

KEGG   Egretta garzetta (little egret): 104134175
Entry
104134175         CDS       T05152                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04144  Endocytosis
egz04218  Cellular senescence
egz04350  TGF-beta signaling pathway
egz04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    104134175 (SMAD2)
   04371 Apelin signaling pathway
    104134175 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104134175 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    104134175 (SMAD2)
   04218 Cellular senescence
    104134175 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 104134175
NCBI-ProteinID: XP_009645984
LinkDB
Position
Unknown
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGQLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPSTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcatccatattgccgttcactccacccgttgtgaagagacttctggggtggaaaaaa
tctgctggtggctctggaggggctggtggtggtgagcagaatggtcaggaggaaaagtgg
tgtgaaaaagcagtgaaaagcttggtcaagaagctaaagaaaacaggacagctggatgag
cttgagaaggcaattaccactcagaattgcaatacaaaatgtgtgacgataccaagcact
tgctctgaaatttggggactgagtacaccaaacacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccagatctctcgatggccgtctacaggtatctcatcgt
aaaggattaccgcatgttatttactgtcgtttgtggcgctggccagatcttcacagtcac
catgaacttaaagcaattgaaaactgtgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagtggagacaccagtcttgcctcccgtactagtg
ccacggcacactgagattctaacggagcttccgcctctcgatgactatacccattccatt
cctgaaaacactaactttccagctggaattgaaccacagagcaattacataccagaaaca
ccacctccaggatatatcagtgaagatggagaaacgagtgaccagcagttgaaccaaagc
atggatacaggatctccagcagagctgtctccaagtactctctccccagttaatcatagc
ttggacttgcaaccagttacttattcggagcctgcattttggtgttcaatagcatattat
gaattaaatcaaagagtgggagaaaccttccatgcatcacagccttccctgaccgtagat
ggctttacagatccatcaaattcagaacgattttgtctaggtctgctttccaatgtaaac
agaaatgctacagtggaaatgacaaggcgacacataggaaggggagtacgtctctattac
attggcggagaagtttttgccgagtgcctaagcgatagcgcgatttttgttcagagcccc
aactgtaatcaaagatatggctggcatcctgcaactgtgtgcaaaattccaccaggatgc
aatctaaaaatctttaataaccaagaatttgctgctcttctggctcaatctgtgaatcag
ggttttgaagcagtttatcagcttactagaatgtgtaccataagaatgagttttgttaaa
ggatggggagctgaatacagacggcaaacagtaacaagcactccttgctggattgaactt
catctgaatggacctctacaatggttggacaaagtattgactcagatgggctccccttca
gtacgctgctccagcatgtcgtaa

DBGET integrated database retrieval system