KEGG   Egretta garzetta (little egret): 104125241Help
Entry
104125241         CDS       T05152                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00052  Galactose metabolism
egz00500  Starch and sucrose metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104125241
   00500 Starch and sucrose metabolism
    104125241
Enzymes [BR:egz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104125241
    3.2.1.20  alpha-glucosidase
     104125241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104125241
NCBI-ProteinID: XP_009635968
LinkDB All DBs
Position
Unknown
AA seq 1454 aa AA seqDB search
MKLLALRDKSKFYQLLWNISTYIFEVDTSLLGKDLLYNFFTEFIPECPNILIAERIDCIP
DQVATKSTCTLRGCCWSPQSDPSVPWCFFSSNHGYKVEGSTRSTQAGFETTLTRLPSPSL
FGNDINTVLLTGEYQTPNRFRFKITDPKTQRFEVPHEHVKSFTGSAASNLNYKVQVKQNP
FGIVVTRVSNGRVLFDTTIGPLQYADQFLQHSIKLPSSNIYGVGEHVHKQYRHDVNWKTW
PIFSRDIGPSGAMHNLYGVQTFFLCLEDSTGASFGVFLMNSNAMEFVVQPAPAVTYRTIG
GILDFYMFLGNTPEQVVQEYLKLVGLPALPSYWSLGFQLSRWNYGSLDEVKKVVQRNRAI
GLPYDAQITDIDYMEEKKDFTYDKVKFQDLPNFAAYMHEYGQKYIIILDPAISIQNLVDG
KPYESYVRGERKKVWVNESDGVTALLGEVWPGETVFPDFTNPECTSWWVEECKLFHKVVP
YDGIWIDMNEISNFIKGSKNGCAQNDLNYPPFTPSILDKLMFSKTLCMDAVQKWGKHYDV
HSLYGYSMAISTQKVIEALFPGKRSFLISRSTFIGSGKHTGHWLGDNAATWDHLKWAIPG
MLEFNLFGIPYIGADICGFFDNTTEELCRRWMQVGAFYPFSRNHNSEGFIPQDPAVFGPD
SVLVKTSKYYLNIRYTLLPYLYTLFYKAHTQGDTVVRPVLHEFYSDEVTWSVDRQFLWGP
GLLISPVLDPGVDAIQAYIPDAVWYEYDTGVKISVRKQWTSMRLPADKLGLHLRGGYIYP
TQQPANTTVASRKNPMGLIIALDDNNAASGDLFWDDGESTGTVQSKAYIYYEFTVSNNVL
QMNAINSNYADPNKLKFEEIKILGALQEITSVTVSQNNVVENSSLNITYYPLQKVAHITG
LQLELGKSYTVEWTQQLSVNERFNCYPSPNPTQEKCEKLGCAWEVTLNSNIPPCYYISDN
AYSVDKVEYTSSGLAANLTLNTSKTRANENFTSPISTLRLEVKYHLNHMLQFKIYDYKNA
RYEVPVPLNLPSSPTSTDKERLYEVSVQKKPFGIQVRRKSTGTVIWDSQLPSFTFSDMFI
QISTRLASQYIYGFGETEHTMFRHNMSWHTWGMFTRDQPPTYKLNSYGYQPFYMALEEDG
NAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVVQEYTALIGRPFMPP
YWSLGFQLCRYGYNSDLEIAHLVEGMKAAGIPYDVQYVDIDYMERQVDFTIGTHFSGLPD
LVNSIKEEGMRFIIILDPAISANETNYPAFSRGVQEDVFIKRPNTNDIIYSKVWPFLPNV
QVNESLPMQTQIQIYGAHVAFPDFFRNSTVGWWKREILEFYNNPTNPLRSVKFDGLWIDM
NEPAAFLNGAIGGCRNDLLNMPPYIPHLGYRSDGLTVKTLCMEGQQYLPDGTPVRHYDVH
SLYGWSQTKPTLEX
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atgaagctattggctttacgggacaagtccaagttttaccagctcctttggaacatatca
acctacatattcgaggtggatacatccttgcttggcaaagacctgctatacaactttttt
acagaatttattccagaatgtccgaacatattaatagcagagagaattgactgcatcccg
gatcaagtagcaacaaagagcacctgcaccctacgtggctgctgctggagtcctcagagt
gatcccagtgtgccctggtgttttttctcttcaaaccatgggtacaaagtggaagggtcg
acaagatcaactcaggcaggatttgagactacattaacaaggctgccatcaccttccctc
tttggaaatgatatcaacactgtcctccttacaggagaatatcagacaccaaatcgcttc
cggttcaagatcactgatcctaaaacacagagatttgaagtgccccatgaacatgtgaaa
tctttcactggatctgcagcctccaatttaaactacaaagtgcaggtgaagcagaacccc
tttggcatcgtggtgaccagagtgagcaacggtagagtgctgtttgatactaccatagga
ccactgcagtatgctgaccagtttttacagcactccatcaaactgccaagcagcaacatt
tacggagtgggagagcacgtgcataagcagtaccggcacgatgttaactggaaaacctgg
cccattttcagcagggatattggcccctctggagcaatgcataacttatatggcgttcaa
actttcttcctgtgtttggaagacagcactggagcctcctttggtgttttcctgatgaac
agcaacgccatggagtttgtggtgcagcctgctccagcagtgacctacagaaccattggt
gggatccttgatttctatatgttcttggggaacactccagagcaagtagtccaggagtac
ctgaagctcgtgggactgccagcattgccgtcatactggagcctgggcttccaactcagt
cgctggaattacgggtctctggatgaggtgaagaaagttgtgcagaggaacagggcgatt
ggactcccttatgatgctcagatcactgatattgactatatggaggaaaagaaagacttt
acttatgacaaagtgaagtttcaagatctccctaattttgcggcttatatgcatgagtat
ggacaaaaatatattatcatattggatcctgctattagcatacaaaatctagttgatggt
aaaccatatgaaagctacgtcaggggagagagaaaaaaagtctgggttaatgaatcagat
ggagtaacagcattacttggggaggtgtggccaggtgaaactgtgttcccagacttcacc
aacccagagtgcactagctggtgggtggaagaatgcaaactgtttcataaagtggtgcca
tatgatgggatctggatcgatatgaatgaaatatccaacttcattaaaggctcaaaaaat
ggttgtgcacagaatgacttaaactatcctcctttcacgcccagtattcttgataagctc
atgttttccaagacactttgtatggatgcagtgcagaagtgggggaaacattatgatgtt
cacagtctttatggatattccatggccatatcaacacagaaagtcattgaagcactgttt
cctggaaaacgaagcttccttatttcaaggtctacttttattggatcaggaaagcacaca
ggacactggctgggagataatgcagcaacatgggatcacttaaaatgggcaatacctgga
atgctggaatttaacctctttggaattccttatatcggagcagatatttgtggtttcttt
gataacaccacagaagaactttgcagacgatggatgcaagtaggagcattttacccattt
tccaggaatcacaatagtgaaggattcatacctcaggatccggctgtgtttggaccggat
tcagtcttggtgaaaacctccaagtattacttgaacattcgctacactttgctgccctac
ctgtatacactcttttataaagctcatactcaaggagacacggttgtgcggccagttttg
catgagttctactctgatgaagtgacgtggagtgtcgacaggcagttcctgtggggtcct
gggctgcttatttcccctgtccttgacccgggtgtggatgcaattcaagcctatattcct
gatgcggtctggtatgagtatgacacaggagtaaaaatctcagtgagaaaacaatggacc
agtatgcgcctgccagcagacaaactgggacttcatttgagaggaggctatatttaccct
actcaacaaccagctaacacaacagttgcaagccgcaagaacccaatgggacttataatt
gccctggatgacaacaatgcagcttctggagacttgttctgggatgatggagaatctact
ggtacagttcagagtaaagcctacatttactatgagtttacagtttccaataatgtccta
caaatgaatgctataaacagcaattatgctgatccaaacaagttaaaatttgaagaaatc
aagatattgggagccctccaggaaataacgtcagttactgtttctcagaacaacgttgtg
gaaaattcttcacttaatatcacttattatcctctacaaaaggttgctcatataacagga
cttcagcttgaactgggaaaatcttacacagtagaatggactcaacaactgagtgtcaat
gaaaggtttaattgttatcccagtcccaatccaacacaagaaaaatgtgaaaaacttggc
tgtgcctgggaagtaacattaaactcgaatattccaccctgctattacatctccgacaat
gcttactctgtagacaaagtagaatacacctcatcaggtttggcagccaacctcacctta
aacacttccaagaccagagctaatgagaatttcacttcaccaattagcacactacgcttg
gaggtgaaatatcatctcaaccacatgctgcaatttaagatttatgattataaaaatgca
cgatatgaggttcccgtaccattaaatcttccgagttccccgacaagcacagacaaggaa
agactctacgaagtatcagttcagaaaaaaccatttggtatacaggttcggcgcaaaagc
acaggaacagtcatctgggattcacagctgccctccttcacgttcagcgacatgttcatt
cagatttctacccgcttagcatcccagtatatatacggatttggagaaactgagcacacc
atgtttcgacataacatgagctggcacacctggggaatgttcacaagggatcagcctcct
acttacaagttgaattcctatggttaccagccattttacatggctcttgaagaagatggc
aatgcccatggagttctcttgcttaacagcaatgcaatggatgtgacgtttcagccaacc
cctgccctgacgtaccggaccactggaggaattcttgacttctacatggttttgggccca
actccagaacttgttgttcaggagtacactgcactgattggacgaccattcatgccaccc
tactggtctttgggattccagttgtgccgctatggatacaacagtgacttggaaatcgcc
catctggtggagggcatgaaggcagctggcattccctatgatgtccaatatgtagatatt
gactatatggaaaggcaagtggacttcaccattggcacacacttttctggattaccagat
ctggttaacagtataaaagaagaaggaatgagatttatcattatcctggatccagctatc
tctgcaaatgaaaccaattaccctgccttctcaagaggtgtgcaggaagatgtcttcata
aaacggcccaataccaatgacattatatattccaaggtctggccattccttcccaacgta
caagtcaatgagtcactgcctatgcaaacccaaatacagatctatggagcacatgttgct
ttcccagatttcttccgcaattccacagtggggtggtggaagagagaaatcctggagttc
tacaacaatcccaccaatcccttgagaagcgtcaagtttgatggtctgtggattgacatg
aatgaaccagcagcttttctgaatggcgccattggtggttgtagaaatgacctcctaaat
atgccaccatatatacctcatttgggataccggtcagatggattaactgtcaaaacccta
tgcatggaaggtcaacaatatcttccagatggtacccctgttagacactatgatgtccac
agtctttatggatggtcacagacaaaacctaccttagagtaa

DBGET integrated database retrieval system