KEGG   Egretta garzetta (little egret): 104125564
Entry
104125564         CDS       T05152                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
egz04115  p53 signaling pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104125564 (CCNE1)
   04114 Oocyte meiosis
    104125564 (CCNE1)
   04115 p53 signaling pathway
    104125564 (CCNE1)
   04218 Cellular senescence
    104125564 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104125564 (CCNE1)
   03036 Chromosome and associated proteins [BR:egz03036]
    104125564 (CCNE1)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104125564 (CCNE1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104125564 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104125564
NCBI-ProteinID: XP_009636330
LinkDB
Position
Unknown
AA seq 361 aa
MEMTRKKQYENQPSWNNVHKNAHMLIPTPDKDDDPVGVDYSHFIHLSVVPTRASPLPVLG
WANRDDVWKNMINKEEMYVRDKLYMQRHPLLQPKMRTILLDWLMEVCEVYKLHRETFYLA
QDFFDRFMATQQNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACTEDEILSM
ELIIMKALNWNLNPLTVVSWLNIYMQVAYLNELYEVLLPQYPQQIFVQIAELLDLCVLDI
GCLEYTYGVLAASALYHFSSSELMQKVSGYEWCEIEECVKWMVPFAMAIREVGSSKLKHF
RGIAPEDLHNIQTHINSLDLLDKAQAKQAILAEQNRTSPFPTGVLTPPQSSKKQSSGLKP
I
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggagatgactagaaaaaagcaatatgaaaaccagccatcctggaataatgttcacaaa
aatgcccatatgctgattcctactccagataaagatgatgatccagttggtgttgattac
tctcactttatacatctaagtgttgttccaactagagcttcaccattaccagttctaggc
tgggcaaacagagatgacgtatggaaaaacatgataaacaaggaagagatgtatgtgagg
gataaactttatatgcaaaggcacccactcctgcaacctaaaatgagaacaatccttcta
gactggctaatggaggtttgtgaagtctacaagcttcatagagaaactttttatttagca
caagatttctttgatcggtttatggcaacacaacagaacgttgtaaaaacactattgcag
cttattggtatctcttctttattcatagcagcaaagcttgaggaaatttatccaccaaag
ttgcaccagtttgcctatgttacagatggagcttgtacagaagatgaaatcctcagtatg
gaattgatcattatgaaggctcttaattggaacttaaatccactgacagttgtatcatgg
ctaaacatttacatgcaagttgcatatttaaatgagctttatgaggtattgctgccacaa
tatccacagcaaatatttgtacaaatagcagagctcttggatctctgtgtgctggatatt
ggctgcttggaatatacatatggagtacttgcagcttctgctttgtatcatttctcctca
tctgagctgatgcagaaagtttcaggttatgaatggtgtgagatagaggaatgtgtcaag
tggatggttccatttgcgatggctataagggaagtaggaagctccaaactcaaacacttt
agaggtatagctcctgaagacttgcacaatatacagacgcacataaacagcttggatttg
ctggacaaagctcaagcaaaacaagccatattggctgagcaaaataggacttcacctttc
cccactggtgtccttacaccaccacagagtagtaagaaacagtcttctggactgaagcca
atatga

KEGG   Egretta garzetta (little egret): 104125860
Entry
104125860         CDS       T05152                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04114  Oocyte meiosis
egz04115  p53 signaling pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104125860 (CCNE2)
   04114 Oocyte meiosis
    104125860 (CCNE2)
   04115 p53 signaling pathway
    104125860 (CCNE2)
   04218 Cellular senescence
    104125860 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104125860 (CCNE2)
   03036 Chromosome and associated proteins [BR:egz03036]
    104125860 (CCNE2)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104125860 (CCNE2)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104125860 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104125860
NCBI-ProteinID: XP_009636642
LinkDB
Position
Unknown
AA seq 405 aa
MSRRSSRLQAKQQQQPLSCQEESPQELQAPEHLQTRKRRTAEEVKKKEDGKIAKKHQYEI
KSCWPPTITGGISPCIIIETPHKESVTTDFSRFKKYRFRNLFINPSPLPELNWGNSKDVW
LNILKKENRYAHCKHFTSLHSSLQPHMRSILLDWLLEVCEVYALHRETFYLAQDFFDRFM
LTQKNINKSMLQLIGITSLFIASKLEEIYAPKIQEFAYVTDGACSEDDIVRMELIMLKAL
KWELCPVTIVSWLNLYLQVDALKDVPEVLLPQYSQEKFIQIAQLLDLCILDVNSLDFQYR
TLAAAALCHYTSVEVVKKASGLDWDSISECVEWMGPFVSVAKKVPAKLKNFKKVAVEDRH
NIQTHTNYLDMLEEVNSGVASAAPGQLSPVSTGGIITPPKSTEKK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccggttgcaagccaagcagcagcagcagcccctgtcatgtcaa
gaagagtctccacaagaactgcaggcaccagaacatctccagaccagaaaaaggagaaca
gcagaggaggttaagaaaaaagaagatgggaaaattgctaaaaaacatcaatacgagatt
aagagttgttggccgcccacgataacaggaggcatctcgccttgtataattattgaaacg
cctcacaaagaatcagtaaccactgacttctcgagattcaaaaaatacaggttcagaaac
ctcttcataaatccatcacctttgccagaactcaactggggaaattccaaagatgtctgg
ctcaacatcctgaagaaggagaacagatacgctcattgcaagcatttcacatcactacat
tctagtttgcaacctcacatgagatcgatactgttagactggctcttagaggtatgtgag
gtgtatgcactccacagggaaaccttctacctagctcaagacttttttgatagattcatg
ttgacgcaaaagaacattaacaagagcatgcttcagcttataggaattacctcgttattc
attgcctccaaacttgaggaaatctacgctcccaaaatacaggaatttgcttacgtcact
gatggtgcttgcagtgaagacgacattgtaagaatggaacttattatgttaaaggcttta
aaatgggagctgtgtccggtgacgattgtctcttggctgaacctctatcttcaagtggat
gctctgaaggatgttccggaagtgctgctacctcagtattctcaggaaaaattcattcag
atagcacagctcttggacctgtgtattctggatgtgaattctttggacttccagtacaga
acactagctgctgcggcgctctgccactatacctcagttgaagtagttaagaaagcttca
ggcttagactgggacagcatttcagagtgcgtcgaatggatgggtccctttgtgagcgtg
gcaaaaaaagtccctgcgaagctgaagaactttaagaaggtggcagtagaagaccggcac
aatatccaaacacacacaaattatttggacatgctggaagaagttaacagtggagtcgca
tctgctgccccaggtcagttatcgcccgtgtcaacaggaggaataataacccctcccaaa
agcacagagaagaagtga

DBGET integrated database retrieval system