KEGG   Egretta garzetta (little egret): 104126330Help
Entry
104126330         CDS       T05152                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:egz01002]
    104126330 (TMPRSS9)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     104126330 (TMPRSS9)
Peptidases [BR:egz01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   104126330 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 104126330
NCBI-ProteinID: XP_009637181
LinkDB All DBs
Position
Unknown
AA seq 1071 aa AA seqDB search
MDQLKPVPGTQGRGRRVSCWKVTVAAAVVGSVTALYLGILLACRPSGETSFEHMVELQGI
TFNSSLQTENSDYYRVLTPALEKLFLSSFQDSQLDWSCTGCTILGYSSLAAYGTISSASL
TGPSEVSPPRPGLKSGSCPGDTFTCLNTQCVRKENPECDGQKDCADASDERGCDCGSRPA
MQTAARIVGGSEASRGEFPWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAA
YTGTTSLRGSDSGAVKMGIARIILHPSYNTDTADYDVAVLELKRPVTFTKYIQPVCLPDA
GHHFPTSKKCLISGWGYLKEDFLVKPEFLQKATVELLDQTLCSSLYSHVLTDRMMCAGYL
EGKIDSCQGDSGGPLVCEEPSGKFFLAGIVSWGIGCAEARRPGVYTRVTKLRDWILDAIS
AFPPSIARPVPPIHSSTNSNMVSSEELSTTTGPIPTTSAPPAASKPVTASGPQECGGRPG
FSKPSKIVGGTDASRGEIPWQVSLKEDSSHFCGATVIGDRWLLSAAHCFNETNPEEIEAY
VGTTSLNGTDGNAVKVNITRVIQHPLFSPITLDFDVAVLELGRPLVFNKYIQPICLPHAT
QKFPVGKKCIISGWGNLQEGNVTKPEILQKASVGIIDQNTCNFLYNFSLTDRMICAGFLE
GKIDSCQGDSGGPLACEVTPGVFYLAGIVSWGIGCAQATKPGVYSRITKLKDWILDTISQ
LSSPGTGAPSSSAITGTSTAAIPTHQPSTPPASPTNRTTLGMKMTTTMKENSTALKTTEP
ARPTQTPVVPCTSHTFKCSSKVCIGKENPECDGIVDCSNGFDERNCDCGLTTALAFSKIV
GGSTAARGEWPWQVSLWLRRKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFL
SGIDGKMEKIFRIYKHPFYNVYSLDYDVALLELNTPVKFSNTIRPICLPDNSHVFHEGAR
CFITGWGSTKEGGLMSKHLQKAAVNMIGEQACKKFYPVQISSRMVCAGFPQGTVDSCSGD
AGGPLACKEPSGKWFLAGITSWGYGCARPYFPGVYTKVTAVQGWIAQNLKL
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atggaccagctaaagcccgtgccaggcacccagggaaggggacggagggtcagctgctgg
aaagtgaccgttgctgctgccgtggtgggcagcgtgacagccctctacctgggcatcctg
ctggcctgtcgtccctcgggagagaccagctttgagcacatggtggagctgcaaggaatc
acattcaacagcagcttgcagacggagaactcagactactacagggtgctgacgcctgct
cttgagaagctgtttctgtccagtttccaggactcccagctggactggagctgcactggt
tgcaccatcctgggctacagctccctggctgcctatgggaccatatcctcagcttctctt
acaggtcccagtgaggtttctcccccgagacctggactgaaatcagggagctgccctggc
gacacgttcacttgcctcaacacccagtgcgtgcggaaagaaaaccctgaatgcgacggc
caaaaagactgcgccgatgcttctgatgaaaggggctgtgactgcgggagccgccctgcc
atgcagactgccgccaggatagtcggaggctcagaggcatccagaggggagttcccatgg
caagtcagcctgcgagagaacaacgagcacttctgtggtgctgcaatcctcacggagaag
tggctggtgtctgccgctcactgctttactgagtttcaggacccagccatgtgggcagct
tacacagggaccacctccctcagaggctcagacagcggcgcagtgaaaatgggcatcgca
cggatcatcctgcacccctcctacaacaccgacacggctgactacgacgtggctgtgctg
gagctgaagagaccggtgaccttcaccaagtacatccagcccgtgtgcttgccggacgct
gggcatcactttcccaccagcaagaagtgcctcatctccggctggggctacctcaaggag
gatttcttggtgaaacccgagttcctgcagaaagcaacagtggagctgctggaccagacg
ctgtgctccagcctctacagccacgtcctcacagacaggatgatgtgtgctggctatctg
gaggggaaaatcgactcctgccagggtgactccggtgggcccctggtttgcgaagagcca
tctggcaagtttttcctggcaggaatcgtgagttggggaattggatgtgctgaagccagg
cggcctggggtttacacacgcgttaccaaactcagagactggatcttggatgctatttct
gcatttcccccctccatagcccgtcccgtcccaccaatacactccagtactaacagtaac
atggtcagctctgaagagctcagcaccaccaccggcccaatccccaccacttcagcaccc
ccagcggccagcaagccagtgactgcgtcgggaccacaagagtgtggaggacgacctggg
ttctctaaacccagcaagatcgtgggaggaacagatgcttccagaggagagatcccctgg
caagtcagcctgaaagaagactcgagccatttctgtggagccaccgtgatcggggaccgc
tggctgctgtcggcagctcactgcttcaatgagacaaatccagaagagattgaagcctac
gtgggaacaacatcactaaatggaacagacgggaacgcagtgaaagtcaacataacaaga
gtgatccagcaccccctcttcagccctattactctggactttgatgtggctgtacttgag
ctgggaagacctcttgtcttcaacaaatacatccaacctatctgtctcccacatgctaca
cagaagtttcctgttgggaagaaatgcatcatttctgggtggggtaacctccaagaaggg
aacgtcaccaagcccgagatcctgcagaaagcgtctgtgggtatcatagaccagaacacc
tgcaacttcctctacaacttctccctcactgaccgaatgatctgtgctggcttcctggag
gggaagatagactcatgccagggagattcaggaggacccttggcctgtgaggtgaccccg
ggagtgttttatctggctggcatcgtgagctggggaattggttgtgcccaggctacgaaa
cctggtgtgtactccagaattaccaaactcaaagactggatcctggataccatctcacag
ttgtccagtcctggcacaggcgccccttccagttcagcaatcactggaacgtctactgca
gccatccccacccaccagcccagcacaccacctgcaagtccaaccaacagaaccactctg
gggatgaagatgactacgactatgaaagaaaactccacagctctgaaaaccactgaacct
gccagacccacccaaactccagtggtgccttgtaccagccacaccttcaagtgttccagc
aaggtctgtattggaaaagaaaatcctgaatgcgatggcattgttgactgcagcaacggc
ttcgatgagcgcaactgcgactgtggcttaacaactgctctggccttcagcaagattgtg
ggtggcagcactgcagctcgaggagaatggccctggcaagtcagtctctggcttcggcgt
aaggagcacaagtgcggggctgtcctcattgccgaccggtggctgctctctgcagctcac
tgctttgatatttacagtgaccccaaaatgtgggtggcctttctaggaacacccttcctg
agtggcatcgatggcaaaatggagaaaatattccgtatctacaagcatcctttttacaac
gtctacagcctggactatgatgtggcactgctggagctgaacacgcccgtcaagttcagc
aacaccatcagacccatctgtctcccagataattcacacgtcttccacgaaggagccaga
tgcttcatcacaggctggggctccacaaaggaaggaggtctcatgtccaagcatctgcaa
aaagcagcagtgaacatgattggagagcaggcctgcaaaaagttctaccctgtccagatc
agcagcaggatggtgtgtgccggtttcccacagggcaccgtcgacagttgttcaggcgat
gcaggtgggcccctggcatgtaaagaaccctcagggaagtggtttctagcaggaatcaca
agctggggctatggctgtgccaggccatacttccctggtgtctacaccaaagtcacggct
gtccagggctggattgcgcagaacctcaagctctga

DBGET integrated database retrieval system