KEGG   Egretta garzetta (little egret): 104126691
Entry
104126691         CDS       T05152                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
egz  Egretta garzetta (little egret)
SSDB
Motif
Pfam: Nore1-SARAH RA Ras_bdg_2 DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 104126691
NCBI-ProteinID: XP_009637576
LinkDB
Position
Unknown
AA seq 224 aa
MPGRDEPSEWEKAELDQVQVEQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVS
VPATKRVPSLQAGRPGLRAQGVKRRTSFYLPKGTVKHLHILSHTRASEVIDALLRKFTVI
DNPRKFALFERSEKDEQVYLRKLADEEQPLRLRLLAGPSEKVLSFVLKENETGEVNWDAF
TLPELHNFLRILQREEEEHVRQLRHRYARCRQKMQEVLATRTPG
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccggggcgggatgagcccagcgagtgggagaaggcagagctggaccaggtgcaggtg
gagcagcggatcaaggagtacaatagccagatcaacagcaacctcttcatgagcctgaac
aaggatggctcctacaccggcttcatcaaggtgcagctgaagctggtgcgccctgtctca
gtgccggccaccaagcgggtcccctccctgcaggcagggcggccggggctgcgtgcccag
ggggtgaagcgccgcacgtccttctacctgcccaaggggaccgtcaaacacctccacatc
ctctcgcacacccgcgccagcgaggtcatcgacgccctcctccgcaagttcactgtcatc
gacaacccccgcaagttcgccctcttcgagaggtccgagaaggatgagcaagtatacctg
cggaagctggctgacgaggagcagcccctgcggctgcggctgctggccggccccagcgag
aaggtgctgagcttcgtcctgaaggagaacgagaccggggaggtgaattgggacgccttc
acgctgccggagctgcacaacttcctgcgcatcctgcagcgggaggaggaggagcacgtg
cgccagctgcggcaccgctacgctcgctgccgacagaagatgcaagaggtgctggccacg
cgcacgccggggtga

DBGET integrated database retrieval system