KEGG   Egretta garzetta (little egret): 104126926
Entry
104126926         CDS       T05152                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04210  Apoptosis
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104126926 (GADD45G)
   04068 FoxO signaling pathway
    104126926 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104126926 (GADD45G)
   04210 Apoptosis
    104126926 (GADD45G)
   04115 p53 signaling pathway
    104126926 (GADD45G)
   04218 Cellular senescence
    104126926 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egz03036]
    104126926 (GADD45G)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     104126926 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     104126926 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 104126926
NCBI-ProteinID: XP_009637833
LinkDB
Position
Unknown
AA seq 121 aa
MPAVGLNAPLPFCSHPDNVAFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNDV
VKLAAIVGPSEESGEPRDLHCILITNPNEDGWKDPALEKLNSFCEESRNVNDWVPTITLP
E
NT seq 366 nt   +upstreamnt  +downstreamnt
atgccggccgtggggctcaacgcaccgctccccttttgcagtcatcccgacaacgtcgct
ttctgcgtgcttgctgcggacgaggaggacgagggggacattgccctgcagatccacttc
accctgatccaggccttctgctgtgagaatgacattgacatcgtgcgggtgaacgatgtg
gtcaagctggctgccattgtggggcccagtgaggagtccggggagccgcgggacctgcac
tgcatcctcatcacgaacccaaatgaagatggctggaaggacccagctctagaaaagctg
aactcattttgtgaagagagccgaaatgtcaatgactgggtgccaactatcaccctgcct
gagtga

DBGET integrated database retrieval system