KEGG   Egretta garzetta (little egret): 104127685Help
Entry
104127685         CDS       T05152                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
egz  Egretta garzetta (little egret)
Brite
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104127685 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core Staphopain_pro
Motif
Other DBs
NCBI-GeneID: 104127685
NCBI-ProteinID: XP_009638669
LinkDB All DBs
Position
Unknown
AA seq 732 aa AA seqDB search
MSETINTNEGKKKTPLNGRRALPPNNSNDEENEVPEMEAFGLIPRGFNPKDYLHVVNVYM
FKDPHEINKQQHHTDKYDSPKLIVRRGQAFQIQIDFNRPYKPETDQFWLEYLIGRYPQQN
KGTYIPILVGDVLKPGEWGAKIIHKENNSVRLSIMSSATCIIGKFRLYVAVWTPFGILRT
HRNSTTDTYILFNPWCQQDAVYLDDEKEREEYVLNDVGIVFHGNINDIKLRSWSYGQFEE
NILDACLFLMDKAQLELSGRGNPIKICRVASAVINSRDDDGVIAGSWDNTYTYGVAPAAW
TGSVDILLEYYSSKQPVRYGQCWVFAGVFNTFLRCLGIPARLVTNYSSAHDNNANLRLDF
FLDDEGQVDTKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDGTPQETSDGMYRCGPA
SVQAVKHGHVCFQFDAPFVYAEVNSDVVYSRRDKNGTQVIEKIDTTHIGQLIVTKEIGGD
GMMEITEEYKFQEGSEEERLALETAVMYGVKKQTTQDSVYQPQTDVDMDFQVQKAVLGSD
FKVTITFRNKSHNYYTATTYLSGNIIYFLSAMEAPFRKQSASVEDLLSFDVAIKSSEYMS
ELLDQASFHFFVTARISETGKILAMQKATVLEIPTLRIKTRGEMVANKETSLTVEFTNPL
KQTLENVMLRLEGPGVLTTMKKEFSQIPKNSTLTWEVKCIPKRPGLRKLIASLNCDALRH
VYGELNVQIQKP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacaataaacaccaacgaagggaagaagaaaactcctctgaatgggagaaga
gccctcccaccaaacaactccaacgatgaagaaaatgaggtccctgagatggaagctttt
ggattgatacctagaggatttaatccaaaagattacctgcatgttgtgaacgtttatatg
ttcaaggacccccacgagattaacaagcagcagcaccacactgacaagtacgacagcccc
aagctgatcgtgcgtcggggacaggctttccaaatccagattgacttcaaccgaccctac
aagccagagacagaccaattctggctggagtatttgataggtcgctacccacagcaaaac
aaaggcacctacatcccgatcctagtaggtgatgtgctgaaacccggtgagtggggagcc
aagattatccacaaggagaacaactctgttcgcctgtccatcatgtcctctgccacctgc
atcattgggaagtttcgcctgtatgttgctgtctggactccctttggcatcctccggaca
cacagaaactcaacaactgacacttacatcctgttcaatccctggtgccagcaggatgcc
gtgtatctggatgatgagaaagaaagggaagaatacgtcctgaatgatgttggcattgtt
ttccatggaaacatcaacgacataaaattaagaagctggagttacggtcagtttgaagaa
aacattctggatgcttgcctgttcctgatggacaaggcacaactggagctctctgggcgt
ggaaaccccatcaaaatctgccgtgttgcctctgcagtgatcaactccagggatgacgat
ggtgtgattgctggatcctgggacaacacgtacacttacggggtcgcaccagcagcctgg
acaggaagcgtggacattctcttggaatactacagttctaagcaaccagtgcgatatggc
cagtgctgggtctttgccggtgtcttcaacacgtttctgaggtgcttggggatacctgcg
agacttgttaccaactattcttctgcccatgataacaatgccaatttacggttggacttc
tttctggatgacgaagggcaagtggacaccaaacttacaaaagactctgtctggaactat
cattgctggaatgaagcttggatgaccagacctgatcttcctgttggttttggaggatgg
caggttgttgatgggacaccccaagaaaccagtgatggtatgtacaggtgtggtccagcc
tcagttcaagccgttaaacatggtcatgtttgcttccaatttgatgctccttttgtctat
gctgaggtgaatagtgatgttgtttactcaagaagggataaaaatggaacccaagtgata
gaaaaaattgacacaacgcatattggccagttgattgtgacgaaggaaattgggggtgat
ggaatgatggagattactgaggagtacaagttccaagaaggctcagaggaggagaggctg
gctctcgagactgctgtgatgtatggcgttaaaaagcaaactacccaagatagcgtgtat
cagccacagacggacgttgacatggatttccaagtgcaaaaagcagtccttggcagtgac
tttaaagtcacgataactttcaggaataaaagtcacaactactacactgctactacatac
ctttcaggcaacataatttatttcctctcagccatggaagccccattcagaaaacagtca
gcaagtgtggaggacctgctaagttttgatgttgcgatcaaatcgagcgagtacatgagt
gagctgctggaccaggcctcctttcatttctttgtgactgcacggatcagtgaaacgggg
aagattctggccatgcagaaggcgacagtcctggaaatacccaccctgaggatcaagacc
cgaggtgagatggtagcaaataaagaaacgtctctgactgtggaattcaccaatcctctg
aaacaaaccctggagaacgtcatgctccgcctcgagggacccggcgtgctgacaacgatg
aaaaaagagttcagtcaaatcccaaagaactctaccttgacctgggaagtaaaatgcatc
ccaaaacgaccagggttacgaaagctgattgcaagcctgaattgtgatgctttgaggcat
gtgtatggtgagctgaacgtccagattcagaaaccatga

DBGET integrated database retrieval system