KEGG   Egretta garzetta (little egret): 104127941Help
Entry
104127941         CDS       T05152                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E-like
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
egz  Egretta garzetta (little egret)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    104127941
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104127941
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N Poxvirus_B22R DUF2393
Motif
Other DBs
NCBI-GeneID: 104127941
NCBI-ProteinID: XP_009638949
LinkDB All DBs
Position
Unknown
AA seq 692 aa AA seqDB search
MGQAATHPSMNWHLKENARDHHTSKFSSKELIVRRGQAFTVSFNGTEQPEQNLTFIAETG
PKPSKPAKTQATFGISSTMSKESWSAVLQSTSSNSVSISISSPPNAVIGRYKLSVQSTSS
GSSSSASLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNKNHINSFGWNFGQ
FQGDILNICLSMLDRSLNYRQDPATDVSHRNDPKYLGRVLSAMVNANDDQGVLLGNWSGN
YEGGKSPGSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNPLDRAADSIWNFHVWNESWFSRSDLGPSYSGWQVLDATPQEE
SGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDPATRKKTLIFSQSTIIG
QFISTKAVGRDDRVDVTNDYKYEEGSTKERDIFKKARKKLGLEDKFDPTAPTQQEIDQKP
DISGKFKVAGPLKVGKDLNLILVLANLQSDAKTVDVNMTAWSTVYTRKPVHEIWKDSTSV
TLSPREEKQFPIKIPYIEYQQKLTTDNTIQVTALCHVEGGIQVLVQRDITLDNPAIDIQV
LGEAKVNKEVDVEVIFTNPIDTEVMNCVLQVEGNDLLRGILEIDIPPLKASEKSSTKLKL
IPFETGPKHLLVNFSCDKFTDIKTFKMVNVID
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctgcaacgcatccaagcatgaactggcacctaaaagaaaatgcaagagat
caccacacaagtaaattttctagcaaagagttgattgtgaggagaggacaggccttcact
gtcagcttcaatggaaccgaacagcctgagcaaaacttaacattcatcgcagaaacaggt
ccaaaaccctcaaagccggctaagacccaggccacatttggtatctccagcaccatgagc
aaggaaagctggagtgcagttctacagtctaccagttccaactctgtgagcatttccatt
tccagcccacctaatgctgtcattggacgttacaagctgagtgttcaaagtacttcaagt
ggcagctcctcttcagcaagccttggcacttttgttttgctctttaatccttggtcttca
ggtgatgacgtgttcatgcctaacaaggctgagtgtgaggaatatgtgctagaagagttt
ggcatcatttttgcgggcaataaaaatcatatcaacagctttggatggaactttggccag
tttcagggagatattctcaatatttgcctttctatgctggatcgaagcttaaactatcgt
caggatcctgccacagatgtatctcaccgaaatgaccctaaatatctggggcgcgttctc
agtgcaatggtcaatgccaatgatgaccaaggggtactgctaggaaactggagtggaaat
tatgagggtgggaaaagcccaggcagctggactggaagtggtgaaatcctgcaaaactgg
aagaaatcaggattcaaacctgttagatatggacaatgttgggtttttgcagcggtactg
accacagtgcttagatgtctggggattcccactcgtacaattacaaacttcagctctgcc
catgatgcagatggaaatctgcgtgtggatgagttttacgatgcttctggaaatcctttg
gacagggcagctgacagcatatggaatttccatgtctggaatgaaagctggttttcccgc
agtgacttgggcccctcatacagtggatggcaagttctggatgcaactccccaagaagaa
agtggaggaatttatcagtgcggtcctgcctcacggaatgccatcaaagaaggagatgta
gatctggactatgactgcccatttgtatttgcagaagtgaatgcagactgtatgtactgg
aattatgaccccgcaactagaaagaaaacattaatattctctcagtctaccataattggc
caattcatcagcacaaaggcagttggtagagatgatcgcgtagatgtcaccaatgattat
aaatatgaagaaggctctacaaaagaaagagatatttttaaaaaagcccgtaagaagctg
ggacttgaggataaatttgatcctacagcaccgacacaacaggaaatcgatcaaaagcct
gacatctcagggaagttcaaggtggctggtcctttaaaagtcggcaaagatctcaatctc
attctggttcttgcaaacttacagtctgatgccaagactgttgatgtaaatatgactgct
tggagcactgtgtacactagaaaaccagttcatgagatctggaaggactccacatctgtc
acactgtctcctagggaagaaaagcaatttcccattaagataccatatattgagtatcag
cagaagttaactacagacaacacaatccaggtaacagctttatgtcacgtagaaggtggg
attcaagtgctcgtgcaaagagacatcaccctggacaatcctgccatcgacatacaggta
cttggtgaagcaaaagtgaataaagaagtggatgtggaagtcatatttaccaatcctatt
gatacagaagtgatgaactgtgtgctgcaggtagaaggcaatgacctgctcagaggaatc
cttgagatagacataccaccactgaaagccagtgagaaatccagtacaaagttgaaactc
atcccttttgagacgggtcccaaacatctacttgttaatttctcctgtgataaatttaca
gatatcaagacctttaagatggtaaatgtgattgactaa

DBGET integrated database retrieval system