KEGG   Egretta garzetta (little egret): 104127947Help
Entry
104127947         CDS       T05152                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6-like
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
egz  Egretta garzetta (little egret)
Brite
Enzymes [BR:egz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     104127947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 104127947
NCBI-ProteinID: XP_009638955
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MAALKIKNVNWQSKLNKAAHHTSDYSSTEAILRRGQAFGITLNLQTTVQSGDNFTFIAST
GPSPAESQQTKAIFNLSEEGASGWSATQEPSEPGCMNFTIFSPANAVIGRYKLRLQIVSG
NKVSSTLLGQFVLLFNPWCPNDDVYMANEKERQEYVLNDSGIIFQGLEKYIQQEAWNYGQ
FEEDILDISLAILDRSLNHRQDPAVDVSNRNNPIYVSRVISAMVNSNDEKGVVEGKWNGK
YCSGTNPLQWSGSVTILRKWYRGRYKPVRYGQCWVFAGVTCTVLRCLGIPTRVITNFNSA
HDRNINLSIDKYVDISGKTLHLTEDSVWNFHVWNESWFIRRDLGSFYDGWQVLDATPQER
SKGIYQCGPASTRAIKEGDVNLDYDSSFVFAAVNADYVTWIHYNNKRKERIYSDTKKIGK
FISTKAVGTNSRVDITDTYKYPEGSLKERQVYKKALKLLGVRSSGKRTKITRPRRRSSIA
WRQNVTQPAQNPSISGKLILDAPPVIGQDILLTLALRNLISDFKTVKVKLRASAILYTRK
PKAEILQLSKSVKLGSEEVKEISFTISYSRYKNSLMDDRKILVTAVCETKQGASLLVEKD
ILLQDPFLTIKVLGPTVVHKAVNVQVTFTNPLSEVVTDCMLRAEGSGLLKEQLRINVARM
APMESSTVQFEIIPYKSGTRQLQVDLVCAHFSDIKGFVMLDVATAQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcggccctgaaaatcaaaaatgtcaattggcaatctaaactaaataaagctgctcat
cacacctctgattacagcagcacagaagcaatcttgaggagaggacaggccttcggcatc
actctgaacctccaaacaacagtgcaatctggggacaacttcacctttattgcaagcaca
gggccatctccagcagaatcacagcagaccaaggccatatttaacctttctgaggagggt
gccagtggctggagcgcaacccaagagcccagtgagcccggctgcatgaacttcacgata
ttcagcccagccaatgctgtcattggacgatacaaactcagactccagatcgtttctggg
aacaaggtctcttcaacactcctgggccagtttgtgctactcttcaatccctggtgtcca
aatgatgatgtctacatggctaatgaaaaggagcgacaggagtatgtcctgaatgatagc
ggaatcatatttcaggggctggaaaaatatattcaacaagaagcctggaactatggacag
tttgaagaggatatccttgatatctctttggcgatactggatcgaagcctgaaccaccgc
caagatccagctgttgatgtatccaaccgaaacaatcctatctacgtgagcagggttatc
agtgctatggttaacagcaatgatgaaaaaggagtagtggaagggaagtggaatggaaag
tactgctcaggaaccaaccccttgcagtggagtggaagtgtgaccatccttcgaaagtgg
tacagggggagatacaaacctgtccggtatggccagtgctgggtctttgcaggagtaacg
tgcacagttctgagatgcttgggaatacctactcgtgtcattacaaacttcaactctgcc
catgacaggaatataaatctgagtattgataagtacgttgacatttctggaaaaaccctg
cacttgactgaagacagtgtgtggaatttccatgtctggaatgaaagctggttcattaga
agagatcttggctctttttatgatggatggcaggttctggatgcaacaccccaggaaaga
agcaaaggtatatatcagtgtggtcctgcctccactagagccattaaggaaggggatgtg
aacctggattatgacagctcatttgtgtttgcagcagtgaatgctgactatgttacttgg
attcactataacaacaaaagaaaagagagaatttattctgatactaagaagattggaaaa
tttatcagcaccaaagcagtgggcaccaactcccgtgtggatatcactgatacttacaaa
tatccagaaggatccctgaaagaaaggcaggtgtataaaaaagcactgaagctgcttggt
gtgagaagcagtgggaaaagaaccaaaattacaagacctagaagacgatcttcaatagca
tggagacaaaatgtgacacagcctgcacaaaaccccagtatctcagggaagctgatcctt
gatgcacctcctgtaattggccaggatatcctccttaccttggcactcaggaacttgatc
tcagatttcaagaccgtaaaggttaaactgagggcttcagccattctgtacacaagaaaa
ccgaaagcagagattttgcagttgtctaagtctgttaaacttggatctgaagaagtgaaa
gagatttcattcacgatctcctattcccgatacaaaaactctctgatggatgacaggaag
atactagtaactgctgtgtgtgaaaccaaacagggagcctcacttctagtggagaaagat
attttacttcaggatccttttctcaccatcaaggtccttggtccaacagtggtacacaag
gctgttaatgtgcaggtcacctttaccaacccactgtctgaagtggtgacagactgcatg
ctgagagcagaaggtagcggcctgctcaaagagcaactcagaatcaatgtggcaagaatg
gcccccatggagagctcaacagtccagtttgaaatcatcccctacaagagcggcaccagg
cagcttcaggtggatttggtttgcgcacatttttcagacattaagggatttgtgatgctt
gatgtggctactgctcagtga

DBGET integrated database retrieval system