KEGG   Egretta garzetta (little egret): 104128034Help
Entry
104128034         CDS       T05152                                 

Gene name
B3GALT1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00601  Glycosphingolipid biosynthesis - lacto and neolacto series
egz01100  Metabolic pathways
Module
egz_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    104128034 (B3GALT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:egz01003]
    104128034 (B3GALT1)
Enzymes [BR:egz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     104128034 (B3GALT1)
Glycosyltransferases [BR:egz01003]
 Glycan extension
  Type 1 chain
   104128034 (B3GALT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 104128034
NCBI-ProteinID: XP_009639046
UniProt: A0A091JCI3
LinkDB All DBs
Position
Unknown
AA seq 326 aa AA seqDB search
MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGHRQLSSVSIARKNVSFGNIRTRPINP
HSFDFLINEPNKCEKSVPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGK
NADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDI
FVNMDNLIYKLLKPNTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPFCSGTG
YIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRV
ITVHQITPEEMHRIWNDMSSKKHLRC
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggtctcatgcttatatgttttgacagtagtttgttgggcaagcgctctt
tggtacttaagtataactcgccctacttcttcctacactggccacagacagctcagtagc
gtatccatagccagaaaaaatgtttcctttggcaacataagaactcgacctataaatcca
cattcctttgactttcttatcaacgaacccaacaaatgtgagaagagtgtccctttcttg
gtcattcttatcagcacaactcacaaagagtttgatgcaaggcaagccattcgagaaaca
tggggagatgaaaacaactttaaaggaattaaaattgccacgctatttcttcttggaaaa
aatgcagatcctgtgttaaatcaaatggtagagcaagaaagccaaatttttcatgacatt
attgtggaagattttatcgactcttatcataacctcactctgaaaacactgatgggaatg
aggtgggtagcaacgttctgttcaaaagctaagtatgttatgaagacagacagtgatatt
tttgtaaatatggataatcttatttataagctgctcaaacctaacactaagccaaggaga
aggtacttcacaggttacgttataaatggaggaccaataagagatgttcgcagtaagtgg
tacatgccaagagatttgtatcccgacagcaattatccacctttctgttcaggcaccggc
tacatattttcagctgacgtagcggaactgatttacaaaacttcccttcataccagactt
cttcatcttgaagatgtgtacgttggactctgtcttcggaaactgggcattcaccccttt
caaaacagtggcttcaatcactggaaaatggcttacagcttgtgcaggtaccgcagggtg
atcacagtccaccagataacaccagaagaaatgcacagaatttggaatgacatgtccagc
aagaaacatcttagatgttaa

DBGET integrated database retrieval system