KEGG   Egretta garzetta (little egret): 104128048Help
Entry
104128048         CDS       T05152                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00250  Alanine, aspartate and glutamate metabolism
egz00410  beta-Alanine metabolism
egz00430  Taurine and hypotaurine metabolism
egz00650  Butanoate metabolism
egz01100  Metabolic pathways
Module
egz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:egz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    104128048 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104128048 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104128048 (GAD1)
   00430 Taurine and hypotaurine metabolism
    104128048 (GAD1)
Enzymes [BR:egz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104128048 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104128048
NCBI-ProteinID: XP_009639064
LinkDB All DBs
Position
Unknown
AA seq 563 aa AA seqDB search
MLGSEKTLTCAPCNNDVGFLQRTNSLEDKGRIVSSLKERQSSKSLLACENSEKESRFRRT
ETDFSNLYARDLLPAKNGEEQTMQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGM
EGFNLELSDNPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANT
NMFTYEIAPVFVLMEQITLRKMREIIGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEV
KTKGMAAVPKLVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILEA
KQKGYIPLFVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLN
GIERANSVTWNPHKMMGVLLQCSAILVREKGILQGCNQMCAGYLFQQDKQYDVSYDTGDK
AIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYTKIKNREEFEMVFEGEPEHT
NVCFWYIPPSLRGMPDCDERREKLHRVAPKIKALMMESGTTMVGYQPQGDKVNFFRMVIS
NPAATKSDIDFLIEEIERLGQEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgttgggaagtgagaaaactctgacctgtgccccttgcaataacgatgtagggttcctg
caaaggaccaacagcctggaagacaagggccggatcgtcagctccttgaaggagaggcag
tcctccaagagcctcttggcgtgcgagaacagcgagaaggaatccaggttccggcgcacc
gagacggacttctccaatctgtatgccagagatttgctgcctgccaagaatggcgaggag
cagaccatgcagttcctgctggaggtggtggacatcctcctcaactacgtgaggaagacg
tttgacagatccaccaaagtgctggacttccaccacccacaccagctcctggagggcatg
gagggcttcaacctggagctctcggacaaccccgagtccctggagcagatcctggtggac
tgccgggacacgctgaaatacggagtgaggacaggtcatcctcgctttttcaatcagctg
tccacaggactggacattattggcttggctggggagtggctgacgtcgactgctaataca
aacatgtttacctatgaaattgcccctgtttttgtcctcatggaacaaataacacttcga
aagatgagagagattattggatggtcaaataaagatggcgatggaatattctcacctgga
ggagctatctccaacatgtacagcataatggctgcacgctacaagtatttccctgaagtc
aaaaccaaaggcatggctgcagtccctaaactggttctctttacctcggaacatagtcac
tactcaataaagaaggctggagctgcacttggatttggaacagacaatgtgattttgata
aaatgcaatgaaagaggcaaaataataccagctgatttggaggcaaaaattttggaagca
aaacaaaaggggtacattcctctctttgtaaatgcaactgcaggcacaacagtatatgga
gcctttgatccaatacaggagattgcagatatatgtgaaaaatataacctctggctccat
gtagatgctgcctggggaggtggactcttaatgtcccgaaagcatcgtcataaactgaat
ggaatagaaagagccaactcagtcacttggaatccacacaagatgatgggagtgttgtta
caatgttctgccattcttgtccgggagaagggtatacttcaaggctgcaaccaaatgtgt
gcaggctatctcttccagcaagacaaacagtatgatgtatcctatgacactggagataag
gcaatacagtgtggccgacatgtggacattttcaaattctggttgatgtggaaggcaaag
ggtacagtaggatttgaaaatcagatcaacaaatgcctggagctggcagaatatctctac
actaaaatcaaaaacagagaagaatttgagatggtttttgaaggggagccagagcataca
aacgtatgtttttggtatattccaccaagtctcaggggcatgccagactgtgatgagaga
agagaaaagttacacagggtggcaccgaaaatcaaagcactgatgatggagtcaggtact
accatggttggatatcagcctcagggcgacaaagtcaacttcttccgaatggtcatctca
aacccagcagcaacgaagtctgacattgacttcctcattgaggaaatagaaagactgggg
caggagctgtag

DBGET integrated database retrieval system