KEGG   Egretta garzetta (little egret): 104128157Help
Entry
104128157         CDS       T05152                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104128157 (SOD1)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104128157 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104128157
NCBI-ProteinID: XP_009639188
LinkDB All DBs
Position
Unknown
AA seq 159 aa AA seqDB search
MAAGAARSTISCDCRCPAQAPTAQFLPSVPGNGPVKVTGRISGLVDGDHGFHVHEFGDNT
NGCTSAGSHFNPEGKQHGGPKDTERHVGDLGNVTAKGGVAEVEIEDSIISLSGPHNIIGR
TMVVHEKCDDLGRGGDNESKLTGNAGPRLACGVIGIAKC
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaggcgctgccaggagcaccatttcctgcgactgccgctgccccgcgcaggca
cctaccgcccagttccttcccagcgtgcccggtaatggaccagtgaaagttactggaaga
atcagtggcttggttgacggagatcatggcttccatgtccatgaatttggggacaataca
aatgggtgtaccagtgcaggttctcacttcaatcctgaaggcaagcagcatggtggacca
aaggatacagagaggcatgtgggagaccttggcaatgtgactgctaaaggaggagtggca
gaagtggaaatagaagattccatcatttctctaagtggaccacacaacatcattggacgt
accatggtggtccatgaaaaatgcgatgacctgggtagagggggagataatgagagcaaa
ttaactggaaatgctggccctcgtttagcttgtggtgtaattggaatagcgaagtgctaa

DBGET integrated database retrieval system