KEGG   Egretta garzetta (little egret): 104128379
Entry
104128379         CDS       T05152                                 

Gene name
TRPV4
Definition
(RefSeq) LOW QUALITY PROTEIN: transient receptor potential cation channel subfamily V member 4
  KO
K04973  transient receptor potential cation channel subfamily V member 4
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104128379 (TRPV4)
Ion channels [BR:egz04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   104128379 (TRPV4)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5
Other DBs
NCBI-GeneID: 104128379
NCBI-ProteinID: XP_009639444
LinkDB
Position
Unknown
AA seq 710 aa
MSLHVPESVPISMPPWKQAPGTKGPAPNPPPVLKVFNRPILFDIVSRGSPAGLDGLLSFL
LTHKKRLTDEEFREPSTGKTCLPKALLNLSGGRNDTIPLLLDIAEKTGNMREFINSPFRD
VYYRGQTALHIAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFGELPLSLAA
CTNQPHIVHYLTENGHKQADLRRQDSRGNTVLHALVAIADNTRENTKFVTKMYDLLLVKC
AKLFPDTNLEALLNNDGLSPLMMAAKTGKIGIFQHIIRREITDEDVRHLSRKFKDWAYGP
VGPEGQVXPLTAPVSHQNRHEMLAVEPINELLRDKWRKFGAVSFYISVVSYLCAMVIFTL
VAYYRPMEGPPPYPYTTTIDYLRLAGEIITLLTGILFFFTNIKDLFMKKCPGVNSFFIDG
SFQLLYFIYSVLVIVTAGLYLGGIEAYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMIQ
KILFKDLFRFLLVYLLFMIGYASALVSLLNPCPSSESCSEEQSNCTVPTYPSCRDSQTFS
TFLLDLFKLTIGMGDLEMLESAKYPGVFIILLVTYIILTFVLLLNMLIALMGETVGQVSK
ESKHIWKLQWATTILDIERSFPVFLRKAFRSGEMVTVGKGTDGTPDRRWCFRVDEVNWXE
VNRWSTVVPRVVELNKSCQPEEVVVPLGTMGAAETRERAPEAAQLSKQML
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgtccctgcacgtccccgagtcggtgccaatctccatgcccccatggaagcaggcacca
ggcacaaaggggccggctcccaacccaccccctgtcctcaaggtcttcaacagacccatc
ctcttcgacatcgtctcccgggggtcaccggccggcctggatgggctcctctctttcctc
ctcacccacaagaagcgtctgacagatgaggagtttcgagagccctccacggggaagacc
tgcctgcccaaggcactgctcaacctgagtgggggcaggaacgacaccatccccctcctc
ctcgacatcgccgagaagacgggcaacatgcgggagttcatcaactcgcccttcagggac
gtctactaccgaggtcagacagccctgcacattgccatcgagcgccgctgcaagcactac
gtggagctgctggtggagaagggagcggacgtgcatgcccaggcccgtggccgcttcttt
cagcccaaggatgaaggtggctacttctacttcggcgagctgcccctctcgctggctgcc
tgcaccaaccagccccacatcgtgcactacctgacggagaacgggcacaagcaggcggac
ctgcggcgccaggattctcgcggcaacaccgtgctgcacgccctggtcgccatcgccgac
aacacccgcgagaacaccaagttcgtcaccaagatgtacgacctgctcctcgtcaagtgc
gccaagctcttccccgacaccaacctggaggcactgctcaacaatgatggcctctccccc
ctcatgatggctgccaagactggcaagatcgggatcttccagcacatcatccggcgggag
atcacagatgaggacgtccggcacctctcgcggaagttcaaggactgggcgtacggcccc
gtggggccagagggccaggtcnncccgctgacagcacccgtgtcccaccagaaccgccat
gagatgttggccgtggagcccatcaacgagctgctgcgcgacaagtggcgcaagttcggg
gccgtctccttctacatcagcgtggtttcctacctctgcgccatggtcatcttcaccctc
gtcgcctactaccgccccatggaaggcccccccccctacccgtacaccaccaccatcgac
tacctgcgcctggccggggagatcatcacccttctcactggcatcctcttcttcttcaca
aacatcaaagatctgttcatgaagaagtgcccaggcgtgaactccttcttcatagacggc
tccttccagctgctctacttcatctactcggtgctggtgattgtcacggcggggctctac
ctgggcggcatcgaggcgtacctggccgtcatggtctttgcgctggtcctgggctggatg
aatgcgctgtacttcacccgggggctcaagctgacggggacctacagcatcatgatccag
aagatcctcttcaaagaccttttccgcttcctcctggtctacttgctcttcatgatcggc
tatgcctcagctctggtgtccctcctcaacccgtgtcccagcagcgagtcctgcagcgag
gagcagtccaactgcacggtgcccacctacccctcctgccgggacagccagaccttcagc
accttcctgctcgacctcttcaagctcacaattggcatgggtgacctggagatgctcgag
agcgccaagtaccccggcgtcttcatcatcctccttgtcacctacatcatcctcaccttc
gtgctcctcctcaacatgctcatcgctctcatgggtgagaccgtgggccaagtctccaag
gagagcaagcacatctggaagctgcagtgggccaccaccatcctggacatcgagcgctcc
ttccctgtcttcctgcggaaagccttccgctcgggggagatggtcaccgtggggaagggc
actgatgggacacctgaccgccgctggtgcttcagggtggacgaggtgaattggtgagag
gtgaatcggtggtcgacagtggtgccacgtgtggtggagctcaacaagagctgccagccg
gaggaggtggtggtgccgctggggaccatgggtgcagcagagacgcgggagcgggccccg
gaggcagcccagctcagtaagcaaatgctgtag

DBGET integrated database retrieval system