KEGG   Egretta garzetta (little egret): 104128531Help
Entry
104128531         CDS       T05152                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00010  Glycolysis / Gluconeogenesis
egz00030  Pentose phosphate pathway
egz00051  Fructose and mannose metabolism
egz00052  Galactose metabolism
egz01100  Metabolic pathways
egz01200  Carbon metabolism
egz01230  Biosynthesis of amino acids
egz03018  RNA degradation
Module
egz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104128531 (PFKP)
   00030 Pentose phosphate pathway
    104128531 (PFKP)
   00051 Fructose and mannose metabolism
    104128531 (PFKP)
   00052 Galactose metabolism
    104128531 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    104128531 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:egz01009]
    104128531 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:egz03019]
    104128531 (PFKP)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     104128531 (PFKP)
Protein phosphatases and associated proteins [BR:egz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104128531 (PFKP)
Messenger RNA biogenesis [BR:egz03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     104128531 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 104128531
NCBI-ProteinID: XP_009639642
LinkDB All DBs
Position
Unknown
AA seq 784 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGEGGGMNAAVRAVVRMGIYVKAKVYFVFEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAYNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPATPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFVEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKMFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSAXXXXXXXXIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTDDSVCLLGMRRRNLV
FQPVAELKNETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHRPKEAE
TGAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccaacccaagttcttcgagaacctgtcgggcaccggaaaggccattggggtg
ctgaccagcggcggcgaggggggaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaaagccaaagtgtattttgtttttgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcaagtatcctgcaagtggga
ggtacagttattggtagtgcacgctgcaaatcctttcgtacccgggagggccgcttgcag
gcagcctacaacttggttcagagaggaatcactaatctttgcgtgattggcggagatggt
agcttaaccggtgccaatctgttccgtgaagaatggagtggacttttggaagaactggca
cagaaaggaaagattgatgaagaagctgttaagaaatatgcttaccttaacattgtggga
atggttggatccatagacaatgacttctgtggcactgatatgactataggtactgactca
gccttgcacagaatcattgaagttgtggatgccatcatgaccactgctcaaagccatcag
aggacatttgttctggaggttatggggagacactgtgggtatctagctcttgttagtgcc
ttagcctgtggtgcagattgggtatttattcctgaatacccaccagaagaaggatgggaa
gattcaatgtgtgttaagctttcagagaatcgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgattgccacaacaaacctataacatcagagaaggttaag
gatcttgttgttcagcggctcggttttgacacccgagtaactatcttgggtcatgtgcaa
agaggtggaactccttcagcttttgacagaattttggcaagtcgtatgggtgtggaagct
gtgcttgcccttttggaagctactccagctacccctgcctgtgtcgtgtccctgtctgga
aaccaggctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgaaggaagatttgttgaggctgtgaggcttcgtgggaggagctttgaaaac
aaccttaacacctacaagttactgtcgcacaaaaaaccagatgccgagcttccaaagact
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgctgcagtg
agggctgcagtgagagttggtataactgaaggccataaaatgtttgctgtcattgatgga
tttgaaggttttgctagagggaagataaaggaaatcagctggggagatgttggaggctgg
acaggccaaggaggatcaattcttggtacaaaacgtactcttcctgcaaagtatttggag
aagattgctgaccagatgcgtactaacaacattaatgccctcatggttattggtggattt
gaggcgtaccttggacttctcgaattgtcagctgccagagagaaatatgatgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactataactgatacgtgtgatcgcatcaaacagtcg
gcnnnnnnnnnnnnnnnnnnnnnnnncatcattgagaccatgggtggttattgcggttat
ctggccaatatgggggccctcgcagctggagcggatgctgcttatatcttcgaagaacag
tttgatattcgagagctccaggctaatgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctgagaaatgagaactgcaatgagaactatacaactgacttc
atttatcagctgtattctgaagaaggaaaaggagtgtttgactgtagaaaaaatgtattg
ggccacatgcagcagggtggggcgccttcgccatttgacagaaacttcgggacaaaaatt
tctgcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccgaaaaggaaaa
gtatttgccaatactgatgactccgtttgtttgctgggaatgcgtagacggaaccttgtt
ttccaacccgtggctgagcttaagaatgaaacagactttgtacacaggattcccaaggag
caatggtggctgaagctgcgaccactgatgaaaatcctggccaagtacaagacgagttat
gatgtttcagattcaggccagctggagcatgttgctatgcacagaccaaaggaggcagaa
accggagccatctaa

DBGET integrated database retrieval system