KEGG   Egretta garzetta (little egret): 104128955
Entry
104128955         CDS       T05152                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04218  Cellular senescence
egz05164  Influenza A
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104128955 (CDK6)
   04115 p53 signaling pathway
    104128955 (CDK6)
   04218 Cellular senescence
    104128955 (CDK6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    104128955 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104128955 (CDK6)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     104128955 (CDK6)
Protein kinases [BR:egz01001]
 Serine/threonine kinases: CMGC group
  CDK family
   104128955 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2
Other DBs
NCBI-GeneID: 104128955
NCBI-ProteinID: XP_009640111
UniProt: A0A091JD38
LinkDB
Position
Unknown
AA seq 326 aa
MDKDSTNLADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTSEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMLQLFRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGNSDVDQLGKIFDVIGLPEE
EDWPNDVALPRNAFTSRPAQPIEKFVPDIDDLGKDLLLKCLAFNPAKRISAYVALSHPYF
HDLEKCKENLDSHMSSSQNSSEVNAS
NT seq 981 nt   +upstreamnt  +downstreamnt
atggataaggacagcacaaacctggctgaccagcagtatgaatgtgtggctgagattggg
gaaggagcctacgggaaggtgttcaaagcccgagacttgaagaacggaggtcgctttgtt
gcgctgaagcgggtacgggtgcagaccagcgaggaggggatgccgctgtccacaatccga
gaggtggcagttttgaggcacctggagacattcgagcaccccaacgtggtcagactgttt
gatgtgtgcaccgtgtcacgaacagacagagagaccaagttaacattagtgtttgaacac
gtggatcaagacttgactacttacttggataaagttccagagcctggagtgcctactgaa
actataaaggatatgatgcttcagctgtttcggggactggattttctgcattcacatcgt
gtggtgcatcgcgacctgaaaccccaaaatatccttgtaaccagcagcgggcagataaag
ttagccgactttggccttgcacgaatctacagttttcagatggctcttacctcagtggtt
gttactttgtggtatagagctcctgaagttttgcttcagtccagctatgcaacaccagtg
gatctttggagtgttggctgcatatttgcagaaatgttccgtcgaaaaccactcttccgt
ggaaattcagatgttgatcagctaggaaaaatctttgatgtaattggactaccagaagaa
gaggactggcctaatgacgttgctcttccaagaaatgctttcacttccagacctgcacaa
cctattgaaaaatttgtaccagatattgatgatctgggcaaagacttgcttctaaaatgc
ttagccttcaatccagccaagagaatatctgcctatgttgccctctctcacccatatttc
catgatctggagaaatgcaaggagaatctggactctcacatgtcatccagccaaaactcc
agtgaggtgaatgcatcataa

DBGET integrated database retrieval system