KEGG   Egretta garzetta (little egret): 104128958Help
Entry
104128958         CDS       T05152                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00052  Galactose metabolism
egz00500  Starch and sucrose metabolism
egz01100  Metabolic pathways
egz04142  Lysosome
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104128958
   00500 Starch and sucrose metabolism
    104128958
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104128958
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104128958
Enzymes [BR:egz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104128958
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104128958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 104128958
NCBI-ProteinID: XP_009640110
LinkDB All DBs
Position
Unknown
AA seq 926 aa AA seqDB search
MVKSYQKLTTEPAACQVEEEGAAPMPAGRGKLAPWWVGSGLLVAAVLLSTITVWVLRQVS
GGWPGPALPPKCLLVPESHRFDCYPERRVVVTQELCESRGCCFIESSLPAQGKRGVPWCF
YPPDFPSYTLESLNQTALGMVGLLVRRTKAYYPRDIMMLRLDVEFETDTRLHIKITDAAN
PRYEVPLDVPRATKRAENPIYSLDFSWDPFGVLLRRRATGTVLLNTTVAPLIFADQFLQI
ATLLPSRFLYGLGEHRGTLLHSLDWSTLTLWARDVAPTESFNLYGAHPFYLLMEEGGDAH
GVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPLWA
LGFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRDFTFDPWKFTSLPSLV
EDLHKHGQRYVMILDPGISSTNPHGSYWPFDEGLKRGLFLNTTQGQPLIGQVWPGFTAFA
DFSNPDTHQWWLENLQHFHAHVPFDGLWIDMNEPSNFMDGSEDGCPPGELDSPPYTPAVL
GDSLSAKTVCASAKQKASVHYNLHNVYGLMEAKATASALIQIRGKRPFVISRSTFPSQGR
YSGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGAFY
PFARNHNTQNEKAQDPTVFSPAARTAMKDVLLTRYSLLPFLYTLFHRAHLQGDTVARPLF
FEFPQDVATLELDRQFLWGQSLLVTPVLEPGVDSVTGYVPRGVWYDFYTGSLVNSSGEML
KMSAPLEHLNLHIREGAILPTQKPGTTSEVTRGNALRLIVALSSSATAWGDLFWDDGESL
DTFERGSYSYLVFNVTQNIFTSTILHTSTEATKVTIDTLSIFGVREPPSKVLLNGQEKPF
SYLDNQVLTVSDLGLSLSQGFSLQWL
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtcgtaccagaagctgacaacggagccagcagcatgccaggtggaggaggaa
ggggctgccccgatgcccgccggccgtgggaagctggccccatggtgggtgggcagcggg
ctgctggtggctgccgtgctgctgagcaccatcaccgtctgggtgctgcggcaagtatcg
gggggctggcctggacctgcgctgccccccaaatgtctcctggtacccgaaagccaccgc
tttgactgctatccggagcggcgtgtggtggtgacccaggagctctgcgaaagccggggg
tgctgcttcattgagagctccctgccggcgcagggcaagcggggggtgccctggtgcttc
tacccccccgatttccccagctacaccctggagagcctcaaccagacagcgctgggcatg
gtggggctgctagtgaggagaacgaaggcctattacccccgggacatcatgatgctgagg
ctggatgtggagtttgagacagacacacggttgcacatcaagataacagatgcagccaac
ccgcggtacgaggttcctctcgacgttccccgggcaacgaagagagcagaaaaccccatc
tacagcctggacttctcctgggacccctttggggtgctgctgcggcgcagggcgacaggg
acagtgctgctcaacaccaccgtggcccccttgatttttgctgaccagtttctccagata
gccacattgctcccgtccaggttcctctatggcctgggggagcaccgtggcaccctactg
cacagcctggactggagcaccctcacactgtgggcacgtgacgtcgctcccacggaatca
ttcaacctctatggagctcaccccttctacctgctgatggaggagggcggagatgctcat
ggcgttttccttctcaacagcaacgcgatggaggtggccctgcagcccgctccgggcctg
acctggaggaccattgggggggtgctggacttttacatcttcctggggcccgatcccaac
atggtcatccagcagtaccagcaggtgataggtttcccggccatgccacccctctgggcg
cttggcttccacctctgccgctggggctacggatccagcaatgagacctggcagactgtg
agagccatgaggaactaccagatcccccaggatgcacagtggaacgacattgattacatg
gacgggtaccgggacttcaccttcgatccctggaagttcacctccctcccctcgctggtg
gaagacctccacaaacacgggcagcgctacgttatgatcttggatcctggaatcagcagc
accaaccctcatggttcctactggcctttcgatgaaggcttgaaacggggcttgttccta
aacaccacccaagggcagccactcatcgggcaggtctggcctggcttcactgcctttgca
gacttctccaacccggacacgcaccagtggtggctggagaacctgcagcacttccatgcc
catgtgccctttgacggcctctggatcgacatgaatgagccatccaacttcatggatgga
tctgaagatggctgccccccaggagagctcgacagcccaccatacaccccagccgtgctg
ggcgattccctttctgcaaagacggtgtgtgcctcagcgaagcagaaagcctcagtgcac
tacaacctccacaacgtctacgggctgatggaagccaaagccacggcgagcgcattgatc
cagatccgggggaagcgcccctttgtcatctcccgctccaccttccccagccagggccgg
tactcggggcactggctgggtgacaaccgaagccagtggaaggacatgtattactccatc
ccagggctgctgagcttcagcctcttcggcatcccgctggttggggcggacatctgcggc
ttctccggcagcacctcagaggagctgtgcacccgctggatgcagctcggcgccttctac
cccttcgcccgcaaccacaatacccagaatgagaaggcccaggacccaacagtgttcagc
cctgcggcgaggacggccatgaaggacgtgctgctgacccgctactccctcctgcccttc
ctctacaccctgttccaccgtgcccacctgcaaggggacactgtcgctcggcccttgttc
tttgagttccctcaggatgtggccaccttggagctggacaggcagttcctgtggggccag
agcctgctggtgacaccggtgctggagcctggggtggactcggtcacaggctacgtcccc
cgtggtgtgtggtacgacttctatacgggctctttggtgaacagcagcggggagatgctg
aagatgtcggccccccttgagcacctcaacctgcatatccgggagggtgccatcctgccc
acccagaaaccggggaccaccagtgaggtgacccgagggaatgccctgcgcctcatcgtg
gccttgtcctcgagtgccaccgcctggggggacctcttctgggacgacggcgagagccta
gacacctttgagcggggcagctactcctacctggtgttcaacgtcacacagaacatcttt
acctccaccatcctccacaccagcaccgaggccaccaaggtcaccattgacacactgagc
atctttggggtacgggagccacccagcaaggtcctcctgaatggccaggagaagcccttc
tcctatctggacaaccaggttctcaccgtgagcgaccttggcctcagcctcagccagggc
ttctccctgcagtggctgtga

DBGET integrated database retrieval system