KEGG   Egretta garzetta (little egret): 104129204
Entry
104129204         CDS       T05152                                 

Gene name
ETS1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein C-ets-1
  KO
K02678  C-ets-1
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    104129204 (ETS1)
Transcription factors [BR:egz03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    104129204 (ETS1)
SSDB
Motif
Pfam: SAM_PNT Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 104129204
NCBI-ProteinID: XP_009640414
LinkDB
Position
Unknown
AA seq 483 aa
MSYYMDTTIGNAAPYPLARPGVMKQGATSPCEDPWVTCGFQSACCQPRTCCPLWDEPATQ
EVPTGLEHYSTDMECADVPLLTPSSKEMMSQALKATFSGFAKEQQRLGIPKDPQQWTETH
VRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELAPDFVGDILWEHLEILQKEE
VKPYPANGVNTTYPESRYTSDYLISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEXX
XXXXXXXPSVILRDPVQTDSLQTDYFTIKQEVVTPDNMCMGRASRGKLGGQDSFESIESY
DSCDRLTQSWSSQSSFQSLQRVPSYDSFDSEDYPTALPNHKPKGTFKDYVRDRADMNKDK
PVIPLLLRKPPLGSGPIQLWQFLRELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKR
KNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPD
ADE
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagttactatatggacacaaccatcggcaatgcagccccttatccgttggctcgccct
ggcgtgatgaagcaaggtgccaccagcccctgtgaggatccctgggtgacctgtggcttc
cagtccgcctgctgccagccgaggacatgctgcccgctctgggacgagcctgccacgcaa
gaagtgcccaccggcctggagcactacagcacggatatggaatgtgcggatgtgccttta
ttaactcccagcagcaaagaaatgatgtctcaggcattgaaagccaccttcagcggcttc
gcaaaagagcaacagcggctgggaatccccaaagatccccagcagtggacggagacgcac
gtgcgggactgggtgatgtgggcagtgaatgagtttagcctgaagggagtggatttccag
aagttttgcatgaacggagctgccctctgtgccctgggcaaggagtgcttcctggagcta
gcacctgactttgtgggagatatcctttgggaacatctggagatcttgcagaaagaagag
gtaaaaccctacccagcaaatggagtgaatacaacatatccagaatcccgctatacttca
gactacttaattagttatggcatcgagcatgcacagtgtgtgcctccctctgagttctct
gagcccagcttcatcacggagtcctaccagaccctccatcccatcagctcggaangnnnn
nnnnnnnnnnnnnnnnnnnatccctcggtcatcctgcgtgacccagtccagacggactcc
ctgcagacagactacttcacgatcaagcaagaagtagtaacgccagataacatgtgcatg
ggacgtgccagtcgaggtaaactgggtggccaggactccttcgagagcatagagagctac
gacagctgcgaccggctgacgcagtcctggagcagccagtcctccttccagagcctgcag
cgcgtcccctcctacgacagctttgactcggaggactaccccactgccctgcccaaccac
aagcccaagggcaccttcaaggactatgttcgagatcgggccgatatgaacaaggacaag
cctgtcattcctttgctcctcaggaaaccacctctcggcagtggacccatccaactgtgg
caattcctgcgggagctactgactgacaagtcctgtcagtccttcatcagctggacgggt
gatggctgggaattcaaactttccgacccagacgaggtggccaggcgatggggcaagagg
aaaaacaaacccaagatgaactacgagaagctgagccgcgggttgcgctactactacgac
aagaacatcatccacaagacggccgggaaacgctacgtctaccgtttcgtctgcgacctg
cagagcctgctgggctacacgcccgaggagctccatgccatgctggacgtcaagccggat
gccgacgagtga

DBGET integrated database retrieval system