KEGG   Egretta garzetta (little egret): 104129322
Entry
104129322         CDS       T05152                                 

Gene name
CCNA2
Definition
(RefSeq) cyclin-A2
  KO
K06627  cyclin-A
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104129322 (CCNA2)
   04218 Cellular senescence
    104129322 (CCNA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104129322 (CCNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104129322 (CCNA2)
   03036 Chromosome and associated proteins [BR:egz03036]
    104129322 (CCNA2)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104129322 (CCNA2)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104129322 (CCNA2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 104129322
NCBI-ProteinID: XP_009640538
LinkDB
Position
Unknown
AA seq 303 aa
MFFIAKENFDVNTDCRFCKNVFDSPSIMDISITSEPEEKKPNVNNVPDYINDIHTYLREM
EVKCKPKMGYMKKQPDITNNMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVL
RGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLILKVLSFDLAAP
TINQFLTQYFLHQQTNAKVESLSMYLGELSLIDADPYLKYLPSVIAAAAFHLAGYTITGQ
TWPESLCKVTGYTLEDIKPCLMDLHKTYLKAAQHTQQSIREKYKSTKYHGVSLIDPPETL
NLL
NT seq 912 nt   +upstreamnt  +downstreamnt
atgttcttcatagctaaagaaaacttcgatgtaaataccgactgccgtttttgcaaaaat
gttttcgattctccaagtattatggatatttcaataacctcggaaccagaagagaaaaaa
ccaaacgttaataacgtgccagactatatcaacgatatccatacataccttagggaaatg
gaggtgaaatgcaagcctaaaatgggttacatgaagaagcaacctgatatcacaaacaac
atgcgggctattcttgtggactggctggtggaagttggagaagaatacaaactgcagaac
gaaaccctgcacttagctgtaaattacattgataggtttctttcttcaatgtctgttctg
agaggaaaacttcagcttgtgggtactgcagctatgctgcttgcatcaaagtttgaagag
atctaccctcctgaagtggcagagtttgtctacatcacagatgacacctataccaagaag
caggttctaaggatggagcacttaattttgaaggttttgtcgttcgacttggcagctcca
acaatcaaccagtttctcactcagtatttcctgcatcagcagacaaatgctaaagtggag
agcctatcaatgtaccttggggagctgagtttaatcgatgctgatccttacctgaaatac
ttgccatcagttattgctgctgcagcatttcatctagcaggctatacaatcactggacaa
acttggcctgaatccctgtgtaaagtaacaggctacaccctcgaagacatcaagccttgc
ctcatggacctacacaagacctacctcaaagcagcacagcacacgcaacagtccataagg
gaaaagtacaagagtacgaagtaccatggagtatcgcttattgacccaccagagacacta
aacttattgtaa

KEGG   Egretta garzetta (little egret): 104131327
Entry
104131327         CDS       T05152                                 

Gene name
CCNA1
Definition
(RefSeq) cyclin-A1
  KO
K06627  cyclin-A
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04110  Cell cycle
egz04218  Cellular senescence
egz04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104131327 (CCNA1)
   04218 Cellular senescence
    104131327 (CCNA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    104131327 (CCNA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:egz03032]
    104131327 (CCNA1)
   03036 Chromosome and associated proteins [BR:egz03036]
    104131327 (CCNA1)
DNA replication proteins [BR:egz03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    104131327 (CCNA1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    104131327 (CCNA1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Cyclin_N2 Big_10 Mltc_N
Other DBs
NCBI-GeneID: 104131327
NCBI-ProteinID: XP_009642785
LinkDB
Position
Unknown
AA seq 401 aa
MRYTSGERWCRICPPLRSHQPSPHLLLPACRCLSSAGGAAVIRCFSGSENTVPSSGKDEL
PNCVVNAASKQGFAIYIDEQEEKENYSCQVAEELESSLCELDTSAMTSNIHLLLDLSTGS
PMVVDTSFQSQPEDHMEDAITLTVGEYAEDIHQYLREAEVRFRPKPYYMRKQPDITTGMR
AILVDWLVEVGEEYRLRTETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLAAKYEEIY
PPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTAPTINQFLLQYIQRHGVCMRTENF
ARYLAELSLLEADPFLKYLPSQTAAAAYCLANYTVNSSFWPETLAAFTGYSLSEIVPCLT
DLHKACLDAPHCQLRAIKEKYKHSKYLQVSLLEPPAVLPLQ
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcggtacacttcaggggagaggtggtgccgcatctgtccacccctccggtcccatcag
ccttctcctcatctgctgttaccagcttgccggtgtctctcatcagcggggggtgctgct
gtcatcagatgcttctctggctctgaaaacaccgtcccttcatctggaaaagatgaatta
cccaactgtgtggtcaatgctgcatccaagcaagggtttgctatctacatagatgaacaa
gaagagaaagaaaactacagctgccaagtggcggaagagctggaatcaagcctgtgtgaa
ctggatactagtgccatgacatccaatattcacctactgttggatctgagtacaggatct
cctatggtagtggatacatccttccagtcccagcctgaggatcacatggaagatgccata
actctgactgtgggagagtatgcagaagacattcatcagtacctccgagaggctgaagta
agattcaggcccaagccctactacatgaggaagcaaccagatattacaaccggaatgcgt
gccatcttggtagactggctggtggaagtaggggaagaatatagacttcggacagagact
ttgtacttggcggtgaacttcctggacaggtttctttcctgcatgtctgttctcagaggg
aagctgcagcttgtaggaacagcagcaattcttctggctgcgaaatatgaagagatctac
ccaccagaagtggatgaatttgtgtatataacggatgatacctacacgaagaggcagctg
ctaagaatggaacacctgcttctcaaagtgttggcttttgacctaacagccccaaccatc
aaccagttcctccttcagtatattcagaggcacggagtctgtatgaggacagagaacttt
gcaaggtaccttgcagagctgagtctccttgaagcggatccttttctgaagtaccttcct
tcacaaacagctgcagcagcctactgtctagcaaactatacagtgaacagctctttctgg
ccagaaacacttgctgcattcactgggtattcattaagtgagatagtgccttgcctgaca
gatctgcataaagcatgccttgatgctccccattgccagctgcgagcaattaaggagaag
tataagcactctaagtacctgcaggtgtctcttctggagcccccagcagttcttcctctg
caatag

DBGET integrated database retrieval system