KEGG   Egretta garzetta (little egret): 104129386
Entry
104129386         CDS       T05152                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04010  MAPK signaling pathway
egz04020  Calcium signaling pathway
egz04144  Endocytosis
egz04510  Focal adhesion
egz04540  Gap junction
egz04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    104129386 (PDGFRA)
   04020 Calcium signaling pathway
    104129386 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104129386 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    104129386 (PDGFRA)
   04540 Gap junction
    104129386 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104129386 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:egz01001]
    104129386 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:egz04090]
    104129386 (PDGFRA)
Enzymes [BR:egz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     104129386 (PDGFRA)
Protein kinases [BR:egz01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   104129386 (PDGFRA)
CD molecules [BR:egz04090]
 Proteins
  104129386 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 104129386
NCBI-ProteinID: XP_009640609
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPWTFLILGCFLTGPFLTFCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAALTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPKAEVTLTNSLDKPVYAFYDSKQGFIG
NFPAGSYTCKTMVKGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNTVQETRFQSILKLIRAKEEDSGYYTLVAENEDETKRYTFSLLIQVPALILDL
VDDHHGSVGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSMSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtacttccccatggacgttcctgatcctgggatgttttctcacaggaccgttccta
acattttgccagcttcctctgccgactattgttcccaataggaatgaaatggtggtgcag
ctgaattccaatttcacactcaaatgctctggagacagtgaagtgagctggcagtaccca
gtgaccgagggaagccacaggatagacattagacatgaagaaaacaacagtggcctcttc
gtgacggtgctcgaagtaggaaatgcctcagctgctcttacgggcttgtatgtttgctat
tataaccacactcaggtggaggatggggaagtggaagggaaggacatctacatctatgtg
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcccactgttatcccttgtcggacaagtgacccaaaagctgaagtgacttta
actaacagtttagacaagcctgtctacgctttctatgacagcaaacaaggcttcatagga
aattttcctgcgggctcatatacgtgcaaaacaatggttaaaggcgtggaattcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccagttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatctacagtggaattatcctgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcacctggagccccag
tttagccctctggaagctgtcaatctgcatgaagtcaaaaattttgtcgtcgatgtgcag
gcatacccagctccaaaaatgtactggttgaaagataacgtgactctgattgaaaatctt
acggagattgttactagttcaaacacagtccaggaaacaaggtttcagagtatattaaaa
ttgatccgggccaaggaggaagacagcggatactatactctggttgctgaaaatgaagat
gagactaaaagatacaccttctccttgctaatacaagttccagccctgatcttagacctc
gtggatgatcatcatggttctgtgggggggcagacggtgaggtgcttggcagaggggacc
ccgcttcccgatgtggaatggctggtttgcaaggacattaaaaagtgcagcaatgacacc
tcatggactcttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaacatggtggaaagccaggtgactttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgggaactgaagcttgtggctcccacc
ttgcgatcagaactaacggtggctgctgccgtcttagtgctgttggtgattgtgataatt
tcactgattgtcctggtcatcatatggaaacagaagccgaggtatgagataagatggaga
gtcattgagtctatcagccctgatggccacgaatacatttatgtggacccaatgcaactg
ccttatgactccagatgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcgtttggaaaagtggttgaagggactgcatatggattgagtcgatctcaaccg
gtgatgaaagtcgctgtgaaaatgctgaaacctaccgctagatccagtgaaaaacaggcg
ctcatgtctgaactgaagataatgacacatcttggcccccacctgaatattgtgaatctg
cttggagcttgtacgaaatcaggtcctatttatataatcactgaatactgcttttatggt
gatttggtgaactatctgcataagaacagggacaatttcctgagccgacacccagagaag
ccaaagaaagatttggatatctttgggatgaacccagctgatgaaagcacaagaagttat
gtgatattatcatttgagaacactggagaatacatggacatgaaacaagctgatacaact
cagtatgtgccaatgctggaaaggaaggagggatctaaatattctgatattcagagatct
gtgtacgatcggcccgcttcatataagaagaaatctatgtcagaatcagaagtcaaaaac
ctcctttcagatgacagttcagagggtctcagcctactggatttgctgagcttcacctac
caggttgcgcggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaatgtcctcctggctcaaggaaaaatcgtgaagatctgtgactttgggctggct
agagacatcatgcatgattccaactatgtctccaagggcagcactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaacctgtacacaacattaagtgatgtctggtct
tacggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgattctactttctacaataagatcaagagtggataccgaatggccaaacccgatcat
gctaccaatgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatttgagtgaaatcgtggagagcttgttgcctggagaatacaaaaag
agctacgagaagattcacctggacttcctgaaaagtgaccacccagctgtcacacgcatg
agaggggactgtgacaatgcttacattggtgtcacctacaagaatgaagacaagctgaag
gacagggagagtggatttgatgagcagaggctgagtgctgacagcgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctacttttatcaagaga
gaggatgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtag

DBGET integrated database retrieval system