KEGG   Egretta garzetta (little egret): 104129726Help
Entry
104129726         CDS       T05152                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00052  Galactose metabolism
egz00500  Starch and sucrose metabolism
egz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104129726
   00500 Starch and sucrose metabolism
    104129726
Enzymes [BR:egz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     104129726
    3.2.1.20  alpha-glucosidase
     104129726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Tmemb_40
Motif
Other DBs
NCBI-GeneID: 104129726
NCBI-ProteinID: XP_009640986
LinkDB All DBs
Position
Unknown
AA seq 1611 aa AA seqDB search
SLGLRRGCCWSPQSDTSIPWCFFSSNHGYKVDGGLRTTRGVENGFGAKRLDLCNWFWREA
SITDPKTPRFEVPHEHVAPFSGQGASDLKYKVDVQQNPFGITVTRASNGKVLFNTSIGPL
VYAQQFLQLSIKLPSSNIYGVGEHVHRRYRHDVNWKTWPMFSRDTAPSGNMENLYGVQTF
FLCLEDNTGASLGVFLMNSNAMEFALQPAPAVTYRTIGGILDFYVFLGDTPEQVVQEYLK
LIGRPALPSYWALGFQLSRYGYGSLSEVKAVGERNRAIGLPCDVQYTDIDYMEARKDFTY
NKVNFTDLPGFRAYLHGYGQKYVIILDPAISTEARADGSPYQAYERGQSKKIWVNESDGV
TPLVGKVWPGATVFPDFTNPDCTSWWVEECRTFHDDVPYDGIWIDMNEVANFVQGSINGC
KQNDLNYPPFTPHVVDRLLYSKTLCMDAVQKWGRQYDVHSLFGYSMTLSTQRAIETLFPG
KRSFLLSRSTFAGSGKYTGHWLGDNTATWDHMKWAIPGMLEFGLFGIPYIGADICGFFED
TTEELCRRWMQVGAFYPFSRNHNTEKFYADEATWSMDQQFLWGPGLLITPVLDPGVDVIR
AYIPDAVWYDYDSVSIIMGRGLLNVHARRSQSWSRKNPMGLIIALDDNNEAVGELFWDDG
ESTGTISSKSYISYEFKVSSNVIEMNVTNNNYTDPDNLRFEEIKILGLLQEPVSVTVLQN
GNVQNSSHNITYNPVHKVALVRGLQLTLGKSYSVRWTPGTSTNEKFDCHPSPNASKEKCK
QLGCVWAEDASQPGVPFCHYDGPYNAYSATDVKYTASGATADLTFRPRQRQAYERPAPPI
PSLRLEVKYHSDRLLQYKIYDSAKKRYEVPVPLNLPASPESTVEGRLYDVTIQNEPFGIQ
IRRRHTGTVIWDSQLPTFTFSDKFIQISTRLASQYLYGFGETEHTAFRRDMNWHTWRMKR
LYFSLQYKLNSYGVHPFYMGLEDDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFY
MVLGPTPELVVQEYTALVGRPVMPPYWALGFQLCRYGYENDTEIAQLVEDMKAARIPYDV
QYADIDYMERQLDFTLNPRFAGLPSLITKIRGEGMRFILILDPAISGNETNYPAFTRGLE
KDVFIKWPNTEDIIYAKVWPDLPNVEVNDTLDWETQVELYRAYVAFPDFFRNSTREWWAR
EIAEVYTNPHNASKSLKFDGLWIPDGSFEYLGSRAEGLIFKTLCMEAQQYLPDGSPISHY
DVHNLYGWSQTKPTLDALRNITKERGIVVTRSTYPSSGKWSGHWLGDNTAAWNQLDKSII
GMMEFSLFGISYTGADICGFFGDSEYELCARWMELGAFYPYSRNHNGKGAKRQDPVAWNS
TFEDLSRKVLNTRYTLLPYLYTLMYEAHAHGSTVVRPLLHEWESAPPWTSMGFWGAVAVS
AYLPNARWYDYYTGEHISARGEFRNLTSPLDHINLHIRGGYVLPQQSPANTTFYSRKNPL
ALTVALNDTQLAEGRLYWDDGVRIDAYEDGAYLLTSFTANQSILEIKVLHRGYADPNNLK
ITQVKILGVTSSPREVTVSQNGEAIQSPHVASYDSQKQVKSSVYGELLSLP
NT seq 4836 nt NT seq  +upstreamnt  +downstreamnt
agcctcggcctccgccgcggctgctgctggagcccccagagcgacaccagcatcccctgg
tgcttcttctcctccaaccatgggtacaaagtggacggcgggctgcggacgactcggggg
gtggagaacgggtttggggccaaacgcctcgatttgtgcaattggttttggcgggaagct
tcgatcactgaccccaaaacaccgcgattcgaagtcccccatgagcacgtggcacctttc
agcggccagggagcctccgacttaaaatataaagttgacgtccagcaaaatcccttcggc
atcacggtgacgcgagcaagcaatggaaaagttttgttcaacaccagcatcggcccgctg
gtctatgcccagcagttcctgcagctctccatcaagctccccagcagcaacatctacggg
gtgggcgagcacgtgcacaggcgataccggcacgacgtcaactggaaaacctggcccatg
tttagcagggacacggctccttccgggaacatggagaacttgtacggcgtccagaccttc
ttcctgtgtttggaagacaacaccggagcctctctcggtgttttcttgatgaacagcaac
gccatggagttcgccctgcagccggcgccggctgtcacttacagaaccattgggggaatt
ctggatttttatgtcttcttgggggacaccccggagcaagtggtgcaggagtacctgaag
ctcatagggcggccggcgctgccctcctactgggccctgggctttcagctcagccgctac
ggttacgggtccctcagcgaggtgaaggccgttggggagcggaacagagcaatcggactc
ccttgcgacgttcagtacacagacatcgactacatggaggcgaggaaggattttacgtac
aacaaagtgaacttcacagacctccccggcttccgagcctacctgcatggctacgggcag
aaatacgtcatcatcctggatccggccatcagcacagaggctcgcgctgacggttccccc
taccaagcctacgagcgggggcaaagcaagaaaatttgggtcaacgagtcggacggagta
acgccgttggttggaaaggtgtggccaggagccaccgtcttcccagacttcaccaacccc
gactgcaccagctggtgggtggaggaatgcagaacgtttcacgacgatgtgccctacgac
gggatctggattgacatgaatgaagtagccaacttcgtccaaggctccatcaacggctgc
aagcagaatgacttgaactatcctcccttcacgccccatgttgtcgataggctcttgtat
tccaagacgctctgcatggatgcggtgcagaagtgggggcggcaatacgatgttcacagc
ctttttggatactcgatgaccctctcaacacagcgagccattgaaactttgtttcctgga
aagcgaagcttcctcctttcgaggtctacttttgcggggtcgggaaagtacacggggcac
tggctgggagataacacagcaacgtgggaccatatgaagtgggcgatacctgggatgctg
gaattcggcctctttggaatcccctatattggagcagacatttgcggtttttttgaagac
accaccgaggagctttgcaggcgatggatgcaagtgggggcattttaccccttctccagg
aaccacaatacggaaaagttttatgctgatgaagcaacgtggagcatggatcagcagttc
ctgtggggaccggggctcctcatcacccccgtgcttgacccaggtgtggacgtcatccga
gcgtatatccctgacgctgtctggtacgattatgattcggtaagtatcatcatggggcgg
gggttgctaaatgtccacgcgaggaggtcacagagctggagccgtaagaatcccatggga
ctcatcattgccctggatgacaacaacgaagcggttggggagttattctgggatgatgga
gaatcaacaggtaccattagcagcaaatcctacatttcctatgagtttaaagtttccagt
aacgtcatagaaatgaacgtcacgaacaacaactacaccgacccggacaacctgaggttt
gaagaaatcaaaatattgggattgctccaggaaccggtgtcggttaccgtgttacagaac
ggcaacgtgcaaaattcttctcataatatcacctataatccagtgcataaggttgctctc
gtacgaggactccagctcacgctcgggaaatcgtactccgtgcggtggacaccgggaacc
agcaccaatgaaaaattcgattgtcatcccagccctaacgcttccaaggaaaaatgcaaa
cagctcggctgtgtctgggctgaagacgcctcccagccgggcgttcccttctgccattac
gacggcccttacaacgcttattccgctactgacgtcaaatacaccgcgtcgggcgcgacg
gccgacctcaccttccgtccgcgccagcgccaggcctacgagcggcccgcgccgcccatc
ccatcccttcgcctggaggtgaaatatcacagcgaccgcttgctgcagtacaagatttat
gattccgcaaagaaacgctacgaggtgccggtgccgctaaatctccctgcgtcccccgag
agcacggtcgagggtcggctttacgatgtgacgattcagaatgagcccttcggcatccag
attcgacgcaggcacacggggacggtgatctgggattctcagctcccgaccttcaccttc
agtgacaagttcattcagatttccacccgtttggcttcccaatatttgtacgggttcggt
gaaaccgaacacaccgcgttccgacgcgacatgaactggcacacctggcggatgaaaaga
ctttatttctccttgcagtacaagttgaattcgtacggtgtccacccgttctacatgggg
cttgaagacgacggcaacgcccacggagttctcctgctcaacagcaacgcaatggacgtg
accttccagcccacgccggctctgacatatcgcacaaccgggggcatcctggacttctac
atggttctggggccaacaccggagcttgtcgttcaggaatacacggcgctggtcgggcga
ccagtcatgccaccctactgggcactcggattccagttatgccgctacggatatgaaaat
gacaccgaaattgcccagctggtggaagacatgaaagcggccaggataccctatgatgtc
cagtacgcagatattgattatatggaacggcaactggacttcacccttaacccgcgcttc
gctggattgccctccctgattactaagatacgaggagaaggaatgaggtttatactaatc
ctggatccagccatatctggtaacgagaccaattaccctgccttcaccagaggtttggag
aaggatgtcttcataaaatggcccaataccgaggatatcatctatgcaaaggtctggcca
gatcttcccaacgtagaggttaacgacacactggattgggaaacccaagtggagctctac
cgtgcgtacgtagcttttccggatttcttccgcaattccacgagggaatggtgggcaaga
gaaattgcggaagtctacaccaatccccacaatgcgtcgaaaagcttgaaatttgacgga
ctctggattcctgatggctcctttgaatatttgggatctagagccgaggggttgattttc
aaaactctctgcatggaagctcagcagtatctcccagacggttcccccatcagtcactat
gatgtccacaacctttacgggtggtcgcaaacaaaaccaaccctcgatgccttgcggaac
atcacgaaggagcgaggaattgttgtcacccgttcaacctaccccagcagtgggaagtgg
tcaggacattggctgggggacaacacggcggcctggaatcagcttgataaatccatcatc
ggcatgatggagttcagtctctttggaatatcctataccggagcagatatctgtggcttc
ttcggagactcggagtatgagctgtgtgctcgatggatggagttgggtgccttttacccg
tattcaaggaaccacaatggaaaaggagccaagaggcaagaccccgttgcctggaattca
acgtttgaagacctttccaggaaagtgctaaataccagatacaccctcttaccctatctc
tacacgttaatgtatgaagcccacgctcacggcagcaccgtcgtccgccctctgctccac
gagtgggaatctgctcccccatggacctccatgggcttctggggcgctgtggcggtgagc
gcgtacctgcccaacgcccgctggtacgactactacacaggtgagcatatcagcgccaga
ggagaattcagaaatttaacatctcccttggatcatatcaacctccatatccgaggaggt
tacgtcctcccccagcagagccctgccaacacgacattttacagccgaaaaaacccattg
gcccttaccgtcgcgttgaacgacacccagcttgcagaaggtcgcctttattgggatgat
ggggtgcgcattgacgcatatgaagatggcgcctatctgctgacctcattcactgctaat
cagagcattttggagataaaggttctgcaccgcggctatgctgatccaaataatttgaag
attacgcaagttaaaattttgggggtgacctcaagcccgcgggaggtgactgtatcacag
aacggtgaagccatccaatctcctcacgttgcctcctatgacagccaaaaacaggttaag
tcgagtgtttacggggaactcctctctttgccgtga

DBGET integrated database retrieval system