KEGG   Egretta garzetta (little egret): 104130173Help
Entry
104130173         CDS       T05152                                 

Gene name
WHSC1
Definition
(RefSeq) histone-lysine N-methyltransferase NSD2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104130173 (WHSC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:egz03036]
    104130173 (WHSC1)
Enzymes [BR:egz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104130173 (WHSC1)
Chromosome and associated proteins [BR:egz03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104130173 (WHSC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET C5HCH AWS PHD HMG_box zf-HC5HC2H HMG_box_2 zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 104130173
NCBI-ProteinID: XP_009641478
LinkDB All DBs
Position
Unknown
AA seq 1368 aa AA seqDB search
MDFSIKRSSQLLTRKINYIKMKQVPEILGNTNGKTQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHEALPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVGTPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPANKERRNRKRSIKYDSLLE
QGLVEAALVSKTSSPTEKKVPAKRDPTQSTIKEDKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHSYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQESAK
QALTKAEKIKMLKPVSGKLRPQWEMGVKQASEAVGMTVEERKAKYTFIYVRDRPHLNPRV
AKEVGIAVEPLEEIDDSSYSNEETTQSLKSMKESGIPNKRRRRTSKLPATDDMQESSQLG
SKNTTPQKSSEQAESKRGIGSPLNRKKTPASTPRSRKGDAVSQFLVFCQKHRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGNLHGNKRNQKKRTKEPT
EDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTNSSKVTETSSSQKNQSATKNLSDACKP
LKKRNRASAAESSTLAFSKSSSPSASLTENEISDGQGDERSESPYESADETQTEVSISSK
KSERGAGTKKEYVCQLCEKTGDLLLCEGLCYRAFHVSCLGLSGRPAGKFICSECTSGVHT
CFVCKERKADVKRCVVSHCGKFYHEACVKKFHLTVFENRGFRCPLHSCLSCHVSNPSHPR
ISKGKMMRCVRCPVAYHAGDVCIAAGCAVIASNSIVCTNHFTAMKGKSHHAHVNVSWCFV
CSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWWPA
EVCHPKNVPSNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGIKGIGK
VFKNALQEAEARFREIKLQREAKETQESERKPPPYKHIKVNKPCGKVQIYTADISEIPKC
NCKPTDENPCGFDSECLNRMLMYECHPQVCPAGERCQNQCFTKRQYPETKIIKTDGKGWG
LVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNY
SRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCKCGAP
NCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRRTKNEGKKESEDDCFRCGDGGQLVLCDR
KSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKEHQDGTVLNSM
LNGQLCCSEHVLGVDSVENQKTEKPRKKLNKLKPKRKQRNRWMRAECK
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcgaaaaattaactacatcaaa
atgaagcaggtaccggagatccttggaaataccaatgggaaaactcagaattgtgaagtg
aatcgtgagtgttctgtctacttgggcaaagcacaactttctgccactctacaagaaggt
gtcatgcaaaaatataatggccatgaggctcttccatttattccagctgataaattgaaa
gatctaacctctcgtgtgtttaatggcgaatctggggcccaagatgccaagctgcgcttt
gaaccccaggaaataaagggagttggaacaccacccaacactactcctatcaagaacggc
tctccagaaattaagctgaaaatcactaaaacctatatgaatggaaagcctctttttgaa
tcttcgatttgtggagacaatggtgcagatgtgtctcagtcagaggaaaatgaacaaaag
ccagcaaacaaggagaggagaaatagaaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaagcagcattagtatcgaagacttcaagccccactgaaaagaaggtt
cctgctaagagagatccaactcaaagtactatcaaagaagacaaagtccatctcttgaag
tataatataggagatctagtgtggtcaaaagtgtctggttttccatggtggccatgtatg
gtttctgctgatcctgttctccattcctacactaaactaaaaggacagaaaaagagtttt
cgtcaatatcatgttcagttttttggcgatgccccagagcgagcatggatatttgaaaag
agccttgtgcccttcaaagaaaaagaccagtttgaacaattatgccaggaaagtgcaaaa
caagccctcactaaagcagagaaaataaagatgttaaagcccgtttcagggaagctgcgg
ccacagtgggagatgggtgttaagcaagcaagcgaagcagtaggcatgacagtggaagaa
cggaaagccaagtacaccttcatctatgttagggacagacctcatcttaatcctcgagtg
gcaaaggaagttggcattgctgtggaaccattagaggagatagatgattcttcttactca
aatgaagaaaccactcaaagtctgaaatcgatgaaggagtctggcattcctaacaagagg
aggagaaggacatcaaaattgcctgccactgatgatatgcaagaaagcagtcagttggga
tctaagaatactactcctcaaaagtcatccgaacaggcggaatccaaaagagggataggc
tcccctctcaatagaaagaaaactccagcatctactccacgaagcagaaagggtgatgca
gtatctcagtttttggtcttttgtcagaagcacagagatgaggtggttgctgaacatcca
gatgcttcaagtgaggagattgaagaattgcttgaatcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactctggtaacttacatggaaataaaagaaaccaaaaaaagaggacaaaggaacctaca
gaagattttgaagttcaggaagcacctaggaaaagactcaggatggataaacagaataat
cggaagagggagacaagcaatgacaaaacagcaaaaacaaactcttctaaggtcacagaa
acctcctcttcacaaaagaaccagtcagcaacgaaaaatctgtctgatgcatgtaaacct
ctgaagaagcgaaatcgggcttcagcagcagaatcttcaactcttgcttttagcaagagt
tcatctccttcagcttccttaactgagaatgagatctccgatggccaaggagatgagcgg
tcagaatctccctatgaaagtgctgatgaaactcagaccgaagtgtctatatcatccaaa
aaatctgagcgaggagcaggaacaaaaaaagaatatgtgtgtcagctgtgtgaaaaaaca
ggtgatctcctactgtgtgaaggactttgctatcgagcttttcatgtaagctgccttggg
ctctctggaagaccagcaggaaaattcatttgtagtgaatgtacatcaggtgtgcatacc
tgttttgtgtgtaaagagagaaaggcagatgtcaaacgctgtgtcgtatcccactgcgga
aaattctaccatgaagcttgcgtgaaaaaatttcatcttactgtgtttgagaacaggggg
tttcgatgtcctctccacagctgcctaagttgtcatgttagtaacccctcacatccacga
atttcaaaaggaaagatgatgcgttgtgttcgctgtcctgttgcataccatgctggagac
gtttgcattgctgcgggatgtgcggtcatcgcttccaacagcattgtttgtacgaatcat
ttcactgccatgaaaggaaagagtcatcatgcgcatgtcaatgtgagctggtgctttgtg
tgttcaaaaggaggaagcttgttgtgctgcgagtcatgtcctgcagcgtttcacccggac
tgtttaaacattgaaatgccagatgggagctggtactgcaatgactgcagggcagggaag
aaactccatttccaggatattatttgggttaaactgggaaattacagatggtggcctgca
gaagtttgccatccgaaaaatgttccctcaaatatccagaaaatgaagcatgaaatcggc
gaatttcctgtgtttttctttggttctaaggattactattggactcaccaagcgcgggtg
ttcccttatatggagggggacagagggagtagataccaggggatcaaaggaattggaaaa
gtcttcaaaaatgctttgcaagaagctgaagctcgatttcgagaaataaagctacagcga
gaagccaaagaaacccaagaaagtgaacgtaaacctccaccgtacaagcatattaaggtg
aataaaccttgtggtaaagtgcagatatatactgctgacatttctgagattcccaagtgc
aactgcaaacccacagatgaaaacccttgcggcttcgattctgagtgcctaaatcggatg
ctgatgtacgaatgccatccacaagtctgtccagcgggagaacggtgccaaaaccagtgc
tttacaaaacgccaataccctgagacaaagatcatcaaaaccgatgggaaagggtggggt
ctggtcgctaagagggacatcaagaagggagagtttgtgaatgagtatgtcggtgagctg
attgatgaagaggaatgtatggcaagaatcaaatatgcacatgaaaatgacattacccac
ttctatatgcttactattgataaggaccgtattattgatgctggccccaaaggaaactat
tctcgttttatgaatcacagctgccaaccaaattgtgaaactctaaaatggacagtaaat
ggagacactcgtgtcggcctgtttgctgtgtgcgatattcctgcagggacggagctgact
tttaattacaaccttgactgtttgggcaatgaaaaaacagtctgcaaatgtggcgcccca
aactgcagtggatttcttggggacagaccaaagaattcttccactaatgcctcagaagaa
aaaggcaaaaagaccaaaaagagaacacggagacgcagaacgaaaaatgaagggaagaaa
gaatctgaagacgattgtttccgttgtggtgacggaggccagctggtattgtgcgacagg
aaatcttgtactaaagcttatcacctctcctgtcttggtttggtgaaacgtccttttggg
aagtgggagtgtccttggcaccactgtgatgtttgtggcaaaccttctgtttctttctgc
cacttctgcccaaattccttctgcaaggaacaccaagacgggacagtactaaattccatg
ttgaatggacagttatgctgctctgaacacgttcttggggtggattctgttgaaaatcag
aagactgagaaaccccgcaaaaaactgaacaagttgaagcctaagagaaagcagaggaac
agatggatgagagctgaatgcaaatag

DBGET integrated database retrieval system