KEGG   Egretta garzetta (little egret): 104130436Help
Entry
104130436         CDS       T05152                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00480  Glutathione metabolism
egz00980  Metabolism of xenobiotics by cytochrome P450
egz00982  Drug metabolism - cytochrome P450
egz00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    104130436
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    104130436
   00982 Drug metabolism - cytochrome P450
    104130436
   00983 Drug metabolism - other enzymes
    104130436
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:egz02000]
    104130436
Enzymes [BR:egz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     104130436
Transporters [BR:egz02000]
 Other Transporters
  Pores ion channels [TC:1]
   104130436
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C GST_N GST_C_5 Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 104130436
NCBI-ProteinID: XP_009641775
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MVESGSRAIHCLLLGFHHEAEYLQERESLLVILKAGLDWILKGISHEVININLKNKPDWF
FEKNPFGLVPVLETSKGQLIYESPITCEYLDEAFPGKKLMPSDPYERAFQKMLLEHFSKI
TPVVFKYFVAVKDGQDTTALKAEIAEKFGKLEEILSKRNTVFYGGDSISMFDYMIWPWFE
RLEPFQLKDALSHTPKLQRWMEAMKEDPAVKATMTDPQTFKGYLQLYLKNSLEACDYGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggtggagagcggcagcagggctatccattgtctcctcttgggttttcatcatgaagca
gaatatctgcaggagagagaatccctccttgttatcctcaaggcgggactggattggatt
ttgaagggcattagccatgaggtaatcaacatcaatctgaagaacaaacctgactggttc
tttgagaagaacccctttggtctggttcctgttctggagaccagcaagggccagctgatc
tatgagtccccaatcacttgtgagtatttggatgaagcatttccggggaagaagttgatg
ccttcggacccatacgagcgagcttttcagaagatgctcttggaacatttctcaaagata
acacctgtagttttcaagtattttgtggcagtcaaagatggacaggacaccacagcactg
aaagcagagattgctgaaaagtttggcaaactcgaagagattctgtccaaacgtaacacg
gtgttttatggtggggactcaatctccatgtttgactacatgatctggccgtggtttgaa
cgtctggaaccattccagctgaaagacgctttgagtcacaccccaaagctccaacgctgg
atggaggccatgaaggaggaccctgctgtcaaggctacaatgactgacccacagacattc
aaaggttacctccagctgtatttgaagaacagccttgaggcatgtgattatgggctctga

DBGET integrated database retrieval system