KEGG   Egretta garzetta (little egret): 104130629Help
Entry
104130629         CDS       T05152                                 

Gene name
GAA
Definition
(RefSeq) LOW QUALITY PROTEIN: lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00052  Galactose metabolism
egz00500  Starch and sucrose metabolism
egz01100  Metabolic pathways
egz04142  Lysosome
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104130629 (GAA)
   00500 Starch and sucrose metabolism
    104130629 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    104130629 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:egz04147]
    104130629 (GAA)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104130629 (GAA)
Exosome [BR:egz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104130629 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N DUF5110
Motif
Other DBs
NCBI-GeneID: 104130629
NCBI-ProteinID: XP_009641990
LinkDB All DBs
Position
Unknown
AA seq 621 aa AA seqDB search
MATSIPVPPQSCWPSSSVPPSSPAAGHCRGCWPEPPFLSGRLNTTVAPLFFADQFLQIST
SLPSHFISGLGEHLTPLVLDTAWTKVTLWNRDMAPVPQANLYGSHPFYLVMEDGGSAHGV
FLLNSNAMDVLLQPSPALTWRTTGGILDFYIFLGPDPKSVVRQYLDVVGFPFMPPYWGLG
FHLCRWGYSSTAITRQVVANMTAAHFPLDVQWNDLDYMDAKRDFTFNKKSFKDYPEMVRD
FHRRGLRYIMIVDPGISSSGPPGTYKPYDEGLKRGVFIQNATGQPLIGKVWPGPTAFPDF
TNPETHEWWHDMVKDFHDQVPFDGMWIDMNEPSNFVEGSQDGCPNNSLEQPPYVPGVFGG
RPRAGTICASSQQYLSSHYNLHSLYGLTEAIASHKYAWGSCHSSCCPGGCTSQGRDPSPC
GDPQEPYAFSPAAQAAMRNALRLRYSLLPFLYTLFHRAHSAGETVARPLFLEXVPDPCLA
CLRSWLFEGCGAGLGPPWARCALRLLFPLFAVIXDSTIHSRGQWILLQAPLDTINVHVLA
GHILPLQEPAFSTAESRKKGMALVVALTPDGFARGELFWDDGESWQTFEKGDYTEILFLA
TQVLRVPVSLPMWEQFVIAWS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagcatccctgtccctccccagagctgctggccctccagctccgtgcctccc
tcctccccggctgctgggcactgccggggctgttggccagagcctccctttctctccggc
aggctgaacaccaccgtcgcgcccctcttcttcgcagaccagttcctgcagatctccacc
tctttgccctcccatttcatttctgggctgggggagcacctgacaccgctggtccttgac
acggcgtggaccaaggtcaccctctggaatcgagacatggcccccgtgccccaggccaac
ctctacggctcccaccctttctacctggtgatggaggatggcggttcggcccatggggtc
tttctgctgaacagcaacgcgatggacgtgctcctgcagcccagcccggccctgacctgg
cgcacgacgggtgggatcctggacttctacatcttcctgggccccgaccccaagagcgtg
gtgcggcagtacctggacgtcgtcgggttccccttcatgcccccgtactggggcctgggc
ttccacctctgccgctggggctactcctccaccgccatcacccggcaggttgtggccaac
atgacggcagcccacttccccctggacgtgcagtggaacgacctggattacatggatgcc
aagagggatttcaccttcaacaagaaaagctttaaggattacccggagatggtgcgggac
ttccaccgccgcggcctgaggtacatcatgatcgtggatcccgggatcagcagttcaggg
cctcctggcacctacaagccctacgacgagggactgaagcgaggggtgttcatccaaaat
gccacggggcagcctctgatcgggaaggtctggccgggcccaacagccttcccggacttc
accaacccggagactcacgagtggtggcacgacatggtgaaggacttccatgaccaagtg
cccttcgatggcatgtggattgacatgaatgagccatcgaacttcgtggagggctcccag
gacggctgccccaacaacagcctggagcagcccccctacgtaccaggtgtgtttggggga
cgcccccgagccgggaccatctgtgcctccagccagcagtacctgtcctcccactacaac
ctgcacagcctctacgggctgaccgaggccatcgcctcccacaagtacgcctggggctcg
tgccacagctcctgctgtcccggaggatgcacgtcccaggggagagacccctccccatgc
ggcgacccgcaggagccgtacgccttcagcccggccgcccaggccgccatgaggaacgcc
ctccgcctccgctattccctcctgcccttcctctacaccctcttccaccgggctcactcc
gccggggagacggtggcgcggcccctcttcctcgagtgagtgccagacccgtgcctcgcc
tgccttcgctcctggctgtttgagggctgcggcgctgggctggggcccccttgggcacgc
tgtgccctacgcctgctctttcctctttttgctgttatttaggactccaccatccacagc
agagggcagtggatcctcctgcaggctcccctggacaccattaatgtccatgttctcgca
gggcacatcctgcccctgcaggagcctgcgttcagcaccgccgagtcccgcaagaagggg
atggccttggtcgtggcactgacgccggacggctttgccaggggagagctgttctgggat
gacggggagagctggcagacctttgagaagggggactacactgagatcctcttcctggcc
acgcaggtgctgagagtccccgtgtcgctgccgatgtgggagcagtttgtgatcgcttgg
tcctga

DBGET integrated database retrieval system