KEGG   Egretta garzetta (little egret): 104130688Help
Entry
104130688         CDS       T05152                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00040  Pentose and glucuronate interconversions
egz00051  Fructose and mannose metabolism
egz01100  Metabolic pathways
Module
egz_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    104130688 (SORD)
   00051 Fructose and mannose metabolism
    104130688 (SORD)
Enzymes [BR:egz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     104130688 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 DUF281 DUF2249
Motif
Other DBs
NCBI-GeneID: 104130688
NCBI-ProteinID: XP_009642052
LinkDB All DBs
Position
Unknown
AA seq 344 aa AA seqDB search
MIPEAGAGWENRPIPEPGPNEVLLQMHSVGICGSDVHYWQHGRIGDFVVKDPMVLGHEAS
GTVVKVGSGVTHLKPGDRVAIEPGVPREMDEFCKTGRYNLSPTIFFCATPPDDGNLCRYY
KHSASYCYKLPDNVTFEEGALIEPLSVGIHACKRAGVTLGSKVFVSGSGPIGLVNVLVAK
MMGAAAVVITDLSASRLQKAKEVGADFTIQVKNETPQEVASKVESLLGCMPEITVECTGV
QACIQAGIYATRSGGTLVLVGLGPEMVTVPIVNAAVREVDIRGIFRYCNTWPVAIALLAS
KRINVKPLVTHRFPLEKALEAFETTKRGEGVKVMLKCDPTDHNP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgatcccagaggcgggtgctgggtgggaaaaccgcccaatcccggaaccgggtcccaat
gaggtcctcctgcagatgcattccgttgggatttgcgggtctgatgttcactactggcag
catggtcgaatcggggattttgttgtgaaggatcccatggtcttgggacacgaagcttcc
gggactgttgttaaagtgggatcaggagtgactcatctgaaaccaggtgatcgagtggct
atcgagcctggcgtcccaagagaaatggatgagttctgcaaaactggccggtataacctg
tctccaaccatattcttctgtgcaacgcctcctgacgatgggaacttgtgccgctactac
aagcacagtgccagctactgctacaagcttccagataatgtcacctttgaagaaggagcc
cttatcgagcccctttcggtgggaatccacgcctgcaaaagggcaggagtcactctggga
agcaaagtctttgtgtccggctctggaccaattggccttgttaatgtgcttgttgctaag
atgatgggtgcagcggctgtggtaattacagatttgtctgcctctcgcctgcaaaaagcc
aaggaggtgggggcagatttcaccattcaggtaaagaacgagaccccacaggaggtggcc
tccaaagtagaaagtctgcttggctgcatgcccgagataaccgtggagtgtacaggagtg
caagcctgcatccaggctggcatttatgccactcgttctggtgggaccttggtgctggtg
gggctggggcctgagatggtcaccgtgcccattgtgaacgccgctgtgcgggaagtggat
atccgggggatattccgctactgcaacacgtggcccgtggcaattgctctgctggcatcc
aagcggatcaacgtcaagcccttggttacacaccgcttccccctggaaaaggctcttgag
gcgttcgagaccaccaagaggggcgagggggtaaaagtcatgctgaagtgtgaccccact
gaccacaacccctga

DBGET integrated database retrieval system