KEGG   Egretta garzetta (little egret): 104131325Help
Entry
104131325         CDS       T05152                                 

Gene name
NEU4
Definition
(RefSeq) sialidase-4
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00511  Other glycan degradation
egz00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    104131325 (NEU4)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    104131325 (NEU4)
Enzymes [BR:egz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     104131325 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3
Motif
Other DBs
NCBI-GeneID: 104131325
NCBI-ProteinID: XP_009642779
LinkDB All DBs
Position
Unknown
AA seq 438 aa AA seqDB search
MGSRHFPARTVLFEKESNGVTYRVPALLYLPCAAKLLAFAEERLSADDAHGNLLVLRRGT
VHGGRGVFLGWEDMRVLETATLQHHRSMNPCPLYDEFTGTLFLFFITVLGRTPEAYQIVT
GQNVTRLCCVTSADQGLSWSMAMDLTQQVIGGAIKDWATFALGPGHGIQLRSGRLLVPAY
SYHIDCKECFGQLCKTTPHSFAFYSDDHGRGWRFGEFIPNLQTGECQLVSVDEEDGSNVL
YCNARSPLGFRVQALSTDDGAVFHGGQLVQRLVEPPPEPKDGCPSPGHHGHAHDITLARG
DPAATPSPPVFFQAPTWVLYSHPTSSMSRVNMGVHLSTFPRDVESWTEPWVIYEGPSAYS
DLAYMELPYNEASIAGGSAIVFACLYENGTRSPYEQISFSMFTLQDVLQNIPLTATAPQR
DSSPLRHGKWGQRSCLLS
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggctcccggcacttccctgcccggaccgtgctctttgagaaggagtccaatggtgtc
acataccgcgtgcccgccctgctctacctgccctgcgcggccaagctgctggcgttcgcg
gaggagcggctgagcgccgacgatgcccacggcaacctgctggtgctgcgccggggcact
gtccatgggggccgcggggtttttttggggtgggaagacatgcgtgtgctggagacagcg
acgctgcaacaccaccggtcgatgaacccctgcccactctatgacgagttcaccggcact
ctcttccttttcttcatcacggtgctgggcaggacacccgaagcctaccagatcgtcacc
ggccaaaacgtcacccgcctctgctgcgtcaccagcgccgaccagggcctgagctggagc
atggccatggatctgacgcagcaggtcattggtggggccatcaaagactgggcgacgttt
gcgctgggccctgggcacgggatccagctgcggtccggccggctgctggtgcccgcctac
agctatcacattgactgcaaggagtgcttcgggcagctctgcaagaccacccctcactcc
ttcgccttctacagcgatgaccatggccggggctggcgctttggggagttcatccccaac
ctgcagacgggcgagtgccagctggtctcagtggacgaggaggatggctctaacgtcctc
tactgcaacgctcgcagccctttgggcttcagggtccaggcgctgagcacggatgacggg
gccgtcttccatggggggcagctggtccagcggctagtcgagcccccccccgagcccaag
gatggctgtccttccccagggcatcatggccatgcccacgacatcacattggcccgaggg
gaccctgcggcgacccccagccctcctgtcttcttccaagcgccgacatgggtcctctat
tcccaccccaccagctccatgtcacgggtcaacatgggggttcacctgagcaccttcccc
agggacgtggagagctggaccgagccatgggtcatctacgagggcccaagcgcttactct
gacctggcttacatggagctgccctacaacgaggcctccatcgctggcggctcagccatc
gtttttgcctgcctctatgagaacgggacacggtcaccctacgagcagatctccttcagc
atgttcacgctgcaggatgtgctccagaacatccccctgacagccacagctccccagcgg
gacagcagccccctacgccatgggaaatgggggcaaaggagctgcctcctctcctag

DBGET integrated database retrieval system