KEGG   Egretta garzetta (little egret): 104131411
Entry
104131411         CDS       T05152                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
egz  Egretta garzetta (little egret)
Pathway
egz04012  ErbB signaling pathway
egz04068  FoxO signaling pathway
egz04110  Cell cycle
egz04115  p53 signaling pathway
egz04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:egz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104131411 (CDKN1A)
   04068 FoxO signaling pathway
    104131411 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    104131411 (CDKN1A)
   04115 p53 signaling pathway
    104131411 (CDKN1A)
   04218 Cellular senescence
    104131411 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 104131411
NCBI-ProteinID: XP_009642869
LinkDB
Position
Unknown
AA seq 144 aa
MPLSQSRTGQIPCSTKVCRNLFGPVDHQELQNDFGNLLRQHLEEAQQRWNFNFETDTPLE
GQFKWERVFLAEQLPQEVTGSKSRSSLVHKIVPKDHLDTICPEVSQQSSEVYRAGSPQSL
KRGQTTMKDFYSSKRRIVPNKPKP
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcccctgtctcagagcaggactgggcagataccatgcagcaccaaagtgtgcaggaac
ctctttggccccgtggaccaccaggagctccagaatgactttgggaacctgttgaggcaa
cacctggaagaagctcaacagcgctggaacttcaactttgagacagatactcccttggaa
ggacaattcaagtgggagagggtcttcctggctgagcagctgccccaggaggtcactggc
agtaagagcaggagctccttggttcacaagatcgtccccaaggaccatcttgatacgatt
tgccctgaggtgtctcagcagagctcggaggtttacagggctggttcccctcagagcttg
aaacgtggacagaccaccatgaaagacttctacagctccaagcggaggattgtccccaac
aagcccaagccgtga

DBGET integrated database retrieval system