KEGG   Egretta garzetta (little egret): 104132021
Entry
104132021         CDS       T05152                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
egz  Egretta garzetta (little egret)
Pathway
egz00230  Purine metabolism
egz01100  Metabolic pathways
egz04020  Calcium signaling pathway
egz04114  Oocyte meiosis
egz04261  Adrenergic signaling in cardiomyocytes
egz04270  Vascular smooth muscle contraction
egz04371  Apelin signaling pathway
egz04540  Gap junction
egz04912  GnRH signaling pathway
egz04914  Progesterone-mediated oocyte maturation
egz04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:egz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104132021 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104132021 (ADCY3)
   04020 Calcium signaling pathway
    104132021 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    104132021 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    104132021 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    104132021 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    104132021 (ADCY3)
   04916 Melanogenesis
    104132021 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    104132021 (ADCY3)
   04270 Vascular smooth muscle contraction
    104132021 (ADCY3)
Enzymes [BR:egz01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     104132021 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 104132021
NCBI-ProteinID: XP_009643557
LinkDB
Position
Unknown
AA seq 1017 aa
MLPAPALEAGLHRTPSAHATLASFGYVPPAPVGDCPQLWVALAVCRQEEGVDPRRRQFSP
QHGCLLALPFLLSSSLISRALPASQSFVGAHDLPARLAPRRSRPECSAEYSADYSVSLPS
DPEHGVGRTHEVTVRSSGPCLCLPRFMRLTFAPESLENLYQTYFRRQRHETLLVLVVFAA
LFDCYVLVMCAVVYAADKLAPVLAAAAGLVAHVLLFILCKYKLLPERVARRFLPYVLWVL
ILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFFITLPLRLAPIVLITAVSCGIHTLVLG
VTVAQQRQDALDEGALLRQILSNVAIYLCAITVGTMSYYMADRKHRKAFLEARQSLEVKL
NLEEQSQQQERLMLSILPKHVADEMLKDMKKDPSQKEMQQFNTMYMYRHENVSILFADIV
GFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQLRIKILGDCYYCICGLPEYREDHAVC
SIMMGLAMVEAISVRNEQELNKLLNEALLERESVQALKGKSTFRLSMRFIDPEMETRYSV
EKEKQSGAAFSCSCVVLFFTALVEVFIDPWLVANYVTFVVGEILLLILTLCSLAAIFPRV
FPKKLVAFSTWIDRTRWARNTWAMAAIVIVTMADIMDMLSCRQDHGRTGNGTAGPPWPGG
CGEQPKYYSYIALLALVATIMLVQVSHMVKLTLMVLITGATGAVNIYAWEHIFDQYARRR
GQQSMSSLVPSKYSMTAMIFIVMLSFYYFSRHVEKLARTLFLWKIDVHDQKERVYEMRRW
NEALVTNMLPEHVARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIE
CLRFLNEIISDFDALLDEPQFRCITKIKTIGSTYMAASGVTPDANANGYSAKKETLSDKE
RWQHLADLADFALAMKVTLMNINYQSFNNFMLRIGMNKGAVLAGVIGARKPHYDIWGNTV
NVASRMESTGVMGNIQVVEETHLILKEYGFRFVRRGAIYVKGKGELLTFFLKGRENS
NT seq 3054 nt   +upstreamnt  +downstreamnt
atgctcccagcacccgccctggaagcgggactgcatcggaccccctccgctcacgccacg
ctggcgagcttcgggtatgtgccaccagcccctgtcggggactgtcctcagctgtgggtg
gccctggctgtttgcaggcaggaggagggtgtggacccaaggaggaggcagttcagcccc
cagcatggctgcctcttggctctgcccttcctcctctcgtccagcctcatctcccgagct
ttgcccgcatcgcagagcttcgtgggtgcccacgatttgcctgctcgcttggccccgcgg
cgctcccggcccgagtgctcggccgagtactccgccgactactcggtgagcctgccgtcg
gaccccgagcacggcgtgggtcggacccacgaggtgacggtgcgcagctcgggaccctgc
ctctgcctaccccgcttcatgcgcctcaccttcgctcccgagtccctggagaacctctac
cagacttacttccgacgccaacgccacgagaccctcctggtgctggtggtcttcgccgcc
ctcttcgactgctacgtcctcgtcatgtgcgccgtggtctacgccgctgacaagctggcc
ccggtgctggcggcggcggccgggctggtcgcccacgtgctgctcttcatcctctgcaag
tacaagctgctccccgagcgggtggcccgcaggttcctgccctacgtcctctgggtcctc
atcttggcccagatcttctgctacctgggtctcaacttctcccgctcgcccgaggccagc
gacacggtgggctggcaggctttcttcgtcttctccttcttcatcacgttgccactgcgc
ttggcgcccatcgtgctcatcaccgccgtctcctgcggcattcacacgctggtgctcggt
gtcaccgttgcccagcagcggcaggacgccctggacgagggcgcgcttctgagacagatc
ctgtccaacgttgccatctacctttgcgccatcacggtgggcaccatgtcctactacatg
gccgaccgcaagcaccgcaaagccttcctcgaagcgcgccagtccctcgaggtcaagctc
aacctggaggagcagagccagcagcaggagcggctgatgctctccatcctgcccaagcac
gtggccgatgagatgctgaaggacatgaagaaggacccgagccagaaggagatgcagcag
ttcaacaccatgtacatgtaccggcacgagaacgtcagcatcctcttcgcagacatcgtg
ggcttcacccagctctcctcgtcctgcagcgcccaggagctggtgaagctcctcaacgag
ctcttcgcccgcttcgacaagctggcagcgaaataccaccagctgcgcatcaagatccta
ggcgactgctactactgcatctgcgggctgcccgagtaccgggaggaccacgccgtctgc
tccatcatgatggggctggccatggtggaggccatttcggtcaggaacgagcaggagctc
aacaagctgctcaatgaagccttgctggagcgcgagtccgtccaggcgctgaaggggaag
agcaccttccgtctctccatgcgcttcatcgaccctgagatggagacacgctactcggtg
gagaaggagaagcagagtggggccgccttcagctgctcctgcgtcgtcctcttcttcacc
gctttggtggaggtcttcattgacccctggttggtggccaactacgtgaccttcgtggtg
ggggagatcctgctgctcatcctcaccctctgctcgttggctgccatcttcccccgggtc
ttccccaaaaagctcgtggccttctccacctggattgacaggacccgctgggcacgcaac
acctgggccatggctgccatcgtcattgtcaccatggctgacatcatggacatgctcagc
tgccggcaggaccatggcaggacgggcaatgggacggcagggccaccatggccaggcggc
tgcggggagcagcccaagtactacagctacatcgccttgctggccttggtggccaccatc
atgctggtgcaggtcagccacatggtcaagctgaccctcatggtgctgatcaccggggcc
accggcgccgtcaacatctacgcctgggagcacatctttgaccagtacgcccgccgccgt
ggccagcaaagcatgtcctcgctggtcccctccaagtactccatgacagcgatgatcttc
atcgtgatgctcagcttctactacttctctcgccacgtggagaagctggccaggaccctc
ttcctctggaagatcgatgtccatgaccaaaaggagcgggtctatgagatgcggcgctgg
aacgaggcccttgtcaccaacatgctgcccgagcacgtggcccggcacttcctgggctcc
aagaagcgggatgaggagctgtacagccagtcctatgacgagatcggcgtcatgtttgcc
tccctccccaactttgccgacttctacacagaggagagcatcaacaacgggggcatcgag
tgcctgcggttcctcaatgagatcatctctgactttgatgcgctcctggacgaaccccaa
ttccggtgcatcaccaaaatcaaaaccatcggcagcacctacatggctgcttctggagtg
acccccgatgccaatgccaacggctacagcgccaagaaggagaccctctcagataaggag
cgctggcagcacttggccgacctggctgactttgccttagccatgaaggtgacgctgatg
aacatcaactaccagtccttcaacaacttcatgctccgcataggcatgaacaagggggcc
gtgctggcgggcgtcatcggtgcccgcaagccgcactacgacatctggggcaacacggtg
aacgtggccagcaggatggaatccaccggcgtgatggggaacatacaggtggtggaggag
acccacctcatcctgaaggagtacggcttccgcttcgtgcgccggggagccatctacgtc
aagggcaaaggggagctgctcaccttcttcctcaagggccgggagaactcctaa

DBGET integrated database retrieval system